KEGG   Rattus norvegicus (rat): 299331Help
Entry
299331            CDS       T01003                                 

Gene name
Hsp90aa1, Hsp86, Hsp90, Hspca
Definition
(RefSeq) heat shock protein 90, alpha (cytosolic), class A member 1
  KO
K04079  
molecular chaperone HtpG
Organism
rno  Rattus norvegicus (rat)
Pathway
Protein processing in endoplasmic reticulum
PI3K-Akt signaling pathway
Necroptosis
Antigen processing and presentation
NOD-like receptor signaling pathway
IL-17 signaling pathway
Th17 cell differentiation
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Pathways in cancer
Prostate cancer
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    299331 (Hsp90aa1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    299331 (Hsp90aa1)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    299331 (Hsp90aa1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    299331 (Hsp90aa1)
   04612 Antigen processing and presentation
    299331 (Hsp90aa1)
   04659 Th17 cell differentiation
    299331 (Hsp90aa1)
   04657 IL-17 signaling pathway
    299331 (Hsp90aa1)
  Endocrine system
   04915 Estrogen signaling pathway
    299331 (Hsp90aa1)
   04914 Progesterone-mediated oocyte maturation
    299331 (Hsp90aa1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    299331 (Hsp90aa1)
   05215 Prostate cancer
    299331 (Hsp90aa1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    299331 (Hsp90aa1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     299331 (Hsp90aa1)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP90
   299331 (Hsp90aa1)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    299331 (Hsp90aa1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    299331 (Hsp90aa1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   299331 (Hsp90aa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
UniProt: 
Position
6q32
AA seq 733 aa AA seqDB search
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPM
GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKEE
KEEEKEKEEKESDDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTR
NPDDITNEEYGEFYKSLTNDWEEHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKN
NIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKK
CLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKD
YCTRMKENQKHIYFITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGK
TLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCI
VTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSV
KDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTVDDTSAAVTEEMPPL
EGDDDTSRMEEVD
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggaaacccagacccaagaccaaccaatggaggaagaggaggtcgaaaccttt
gcctttcaggcagaaattgcccagttaatgtccttgatcatcaacactttctactcgaac
aaagagatctttctgagggagctcatttccaactcctcagacgctctggataagatcaga
tacgagagcttgaccgaccctagtaaactggactcggggaaggagctgcacattaatctc
attcccaacaagcaagaccgaaccctcactattgtggatactggcattggaatgaccaag
gctgacttgatcaataaccttggcactattgccaagtcaggcaccaaagccttcatggag
gctttgcaggctggtgcagatatctctatgattggccagtttggtgttggtttttactct
gcgtatttggttgctgagaaagtgactgtcatcaccaagcataatgatgacgagcagtac
gcctgggagtcctcagctggaggatccttcactgtgaggacagacacaggtgaaccaatg
ggtcgtggaacaaaggttatcttgcatctaaaagaagaccaaactgagtatttggaggaa
aggagaataaaagaaattgtgaagaaacattctcagtttattggctaccccattactctc
tttgtggagaaggaacgtgacaaggaagtcagtgatgatgaggctgaagaaaaggaagag
aaagaggaagagaaagaaaaagaagaaaaggagtctgatgacaagcctgaaatagaagat
gttggttctgatgaagaagaagaagagaagaaggatggtgacaagaagaaaaagaagaag
ataaaggaaaagtacattgatcaagaagaactcaacaaaacaaagccgatctggaccaga
aatcctgatgacattacgaatgaagaatacggagagttctacaagagcttaaccaacgac
tgggaagaacatttggcagtaaagcatttttctgttgaaggacaattagaattccgggct
cttctttttgtcccaagacgcgctccttttgatctatttgaaaacagaaagaaaaagaac
aacatcaagttgtatgttcgcagagtttttatcatggataactgtgaggagttaatcccc
gagtatctgaatttcatcagaggggtggtggattctgaggatctccctctaaatatttcc
cgtgaaatgctgcaacaaagcaaaattctgaaagttatcaggaagaatttggtcaagaaa
tgcctagaactatttactgaactggctgaagataaagagaactacaaaaagttttatgag
cagttctcaaaaaatataaagcttggaattcatgaagactctcaaaatcggaagaagctt
tcagagctgttgagatactacacatctgcttctggggatgagatggtttctctgaaggac
tactgcaccagaatgaaggaaaaccagaagcacatctattttatcacaggtgagaccaag
gaccaggttgctaactcagcctttgtggaacgtctccgaaagcatggcttagaagtaatc
tatatgattgagcccattgatgagtattgtgtgcaacagctgaaggaatttgagggcaag
accttggtgtcagttaccaaagaaggactggaacttccagaagatgaagaggaaaagaag
aaacaggaagagaaaaagacaaaatttgagaacctctgcaaaattatgaaggatatttta
gagaaaaaggttgaaaaggtggttgtgtcaaaccgattggtgacatccccatgctgtatt
gtcacaagcacatatggctggacagcaaacatggagagaatcatgaaagctcaagccctc
agagacaactcaacaatgggttacatggcagcaaagaaacacctggagataaaccctgat
cactccattattgaaaccttaaggcaaaaggcagaggctgacaagaatgacaagtctgtg
aaagatctggtcatcttgctgtacgaaacagcactcctgtcttccggcttcagtctggaa
gatccccagacccatgctaacaggatctacaggatgatcaagcttggtctaggtattgat
gaggatgatcctactgtggatgataccagtgctgctgtaactgaagaaatgccacccctg
gaaggagatgatgacacatcacgcatggaagaagtagactag

DBGET integrated database retrieval system