KEGG   Rattus norvegicus (rat): 299331Help
Entry
299331            CDS       T01003                                 

Gene name
Hsp90aa1, Hsp86, Hsp90, Hspca
Definition
(RefSeq) heat shock protein 90, alpha (cytosolic), class A member 1
  KO
K04079  
molecular chaperone HtpG
Organism
rno  Rattus norvegicus (rat)
Pathway
Protein processing in endoplasmic reticulum
PI3K-Akt signaling pathway
Antigen processing and presentation
NOD-like receptor signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Pathways in cancer
Prostate cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    299331 (Hsp90aa1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    299331 (Hsp90aa1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    299331 (Hsp90aa1)
   04612 Antigen processing and presentation
    299331 (Hsp90aa1)
  Endocrine system
   04915 Estrogen signaling pathway
    299331 (Hsp90aa1)
   04914 Progesterone-mediated oocyte maturation
    299331 (Hsp90aa1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    299331 (Hsp90aa1)
   05215 Prostate cancer
    299331 (Hsp90aa1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     299331 (Hsp90aa1)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP90
   299331 (Hsp90aa1)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    299331 (Hsp90aa1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    299331 (Hsp90aa1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   299331 (Hsp90aa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
6q32
AA seq 733 aa AA seqDB search
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPM
GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKEE
KEEEKEKEEKESDDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTR
NPDDITNEEYGEFYKSLTNDWEEHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKN
NIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKK
CLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKD
YCTRMKENQKHIYFITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGK
TLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCI
VTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSV
KDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTVDDTSAAVTEEMPPL
EGDDDTSRMEEVD
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggaaacccagacccaagaccaaccaatggaggaagaggaggtcgaaaccttt
gcctttcaggcagaaattgcccagttaatgtccttgatcatcaacactttctactcgaac
aaagagatctttctgagggagctcatttccaactcctcagacgctctggataagatcaga
tacgagagcttgaccgaccctagtaaactggactcggggaaggagctgcacattaatctc
attcccaacaagcaagaccgaaccctcactattgtggatactggcattggaatgaccaag
gctgacttgatcaataaccttggcactattgccaagtcaggcaccaaagccttcatggag
gctttgcaggctggtgcagatatctctatgattggccagtttggtgttggtttttactct
gcgtatttggttgctgagaaagtgactgtcatcaccaagcataatgatgacgagcagtac
gcctgggagtcctcagctggaggatccttcactgtgaggacagacacaggtgaaccaatg
ggtcgtggaacaaaggttatcttgcatctaaaagaagaccaaactgagtatttggaggaa
aggagaataaaagaaattgtgaagaaacattctcagtttattggctaccccattactctc
tttgtggagaaggaacgtgacaaggaagtcagtgatgatgaggctgaagaaaaggaagag
aaagaggaagagaaagaaaaagaagaaaaggagtctgatgacaagcctgaaatagaagat
gttggttctgatgaagaagaagaagagaagaaggatggtgacaagaagaaaaagaagaag
ataaaggaaaagtacattgatcaagaagaactcaacaaaacaaagccgatctggaccaga
aatcctgatgacattacgaatgaagaatacggagagttctacaagagcttaaccaacgac
tgggaagaacatttggcagtaaagcatttttctgttgaaggacaattagaattccgggct
cttctttttgtcccaagacgcgctccttttgatctatttgaaaacagaaagaaaaagaac
aacatcaagttgtatgttcgcagagtttttatcatggataactgtgaggagttaatcccc
gagtatctgaatttcatcagaggggtggtggattctgaggatctccctctaaatatttcc
cgtgaaatgctgcaacaaagcaaaattctgaaagttatcaggaagaatttggtcaagaaa
tgcctagaactatttactgaactggctgaagataaagagaactacaaaaagttttatgag
cagttctcaaaaaatataaagcttggaattcatgaagactctcaaaatcggaagaagctt
tcagagctgttgagatactacacatctgcttctggggatgagatggtttctctgaaggac
tactgcaccagaatgaaggaaaaccagaagcacatctattttatcacaggtgagaccaag
gaccaggttgctaactcagcctttgtggaacgtctccgaaagcatggcttagaagtaatc
tatatgattgagcccattgatgagtattgtgtgcaacagctgaaggaatttgagggcaag
accttggtgtcagttaccaaagaaggactggaacttccagaagatgaagaggaaaagaag
aaacaggaagagaaaaagacaaaatttgagaacctctgcaaaattatgaaggatatttta
gagaaaaaggttgaaaaggtggttgtgtcaaaccgattggtgacatccccatgctgtatt
gtcacaagcacatatggctggacagcaaacatggagagaatcatgaaagctcaagccctc
agagacaactcaacaatgggttacatggcagcaaagaaacacctggagataaaccctgat
cactccattattgaaaccttaaggcaaaaggcagaggctgacaagaatgacaagtctgtg
aaagatctggtcatcttgctgtacgaaacagcactcctgtcttccggcttcagtctggaa
gatccccagacccatgctaacaggatctacaggatgatcaagcttggtctaggtattgat
gaggatgatcctactgtggatgataccagtgctgctgtaactgaagaaatgccacccctg
gaaggagatgatgacacatcacgcatggaagaagtagactag

DBGET integrated database retrieval system