KEGG   Rattus norvegicus (rat): 299638Help
Entry
299638            CDS       T01003                                 

Gene name
Sirt6
Definition
sirtuin 6 (EC:2.4.2.31)
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
rno  Rattus norvegicus (rat)
Pathway
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    299638 (Sirt6)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     299638 (Sirt6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
7q11
AA seq 330 aa AA seqDB search
MSVNYAAGLSPYADKGKCGLPEIFDPPEELECKVWELARLMWQSSTVVFHTGAGISTASG
IPDFRGPHGVWTMEERGLAPKFDITFENARPSKTHMALVQLERMGFLSFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECPKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGE
LRDTILDWEDALPDRDLTLADEASRTADLSVTLGTSLQIRPSGNLPLATKRRGGRLVIVN
LQPTKHDRQADLCIHGYVDEVMCKLMKHLGLEIPTWDGPRVLEKALPPLPRPVAPKAEPP
VHLNGSYKPKPDSPVPHRPPKRVKTEAAAS
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaattatgcagcagggttgtcgccatacgcggataagggcaagtgcgggctg
cccgagatattcgacccaccagaggagctggaatgcaaggtgtgggagctggcgcggctg
atgtggcagtcctccactgtggttttccacaccggcgcaggcatcagcaccgcctccggc
atccccgacttcaggggcccccatggcgtgtggaccatggaggaacgaggcctcgccccc
aagtttgacatcacctttgagaatgcccggccctcgaagacccacatggcccttgttcag
ctggaacgcatgggcttcctcagcttcctggtcagccagaatgtagacgggctacatgtg
cgctcgggcttccccagggacaagctggccgagctgcacggaaacatgtttgtagaggag
tgccccaagtgtaagacgcagtacgtgagagacacggtcgtgggtaccatgggcctcaag
gccactggccggctctgcaccgtggccaaggcgaggggacttcgggcctgtagaggggag
ctgagagacaccattctggactgggaggatgcgttgcctgaccgggacctaacgctcgct
gatgaggccagcaggactgcagacctgtctgtcaccctgggtacctcactgcagatccgc
cccagcgggaacctgccccttgccactaagcgccgcggaggccgtctggtcattgtcaac
ctgcaacccacaaaacatgaccgccaggctgatctgtgcatccatggctacgtggatgag
gtgatgtgcaagctcatgaagcacctggggctggagatccccacctgggatggaccccga
gtgctagagaaagccctgccaccgctgccgcgcccagtagcacccaaggctgagccccct
gtgcatctcaatggttcctataagcccaagcccgacagccctgtaccccacaggcctccc
aaaagagtgaagacagaggctgccgccagctga

DBGET integrated database retrieval system