KEGG   Rattus norvegicus (rat): 300992Help
Entry
300992            CDS       T01003                                 

Gene name
Cacna2d2
Definition
calcium channel, voltage-dependent, alpha 2/delta subunit 2
Orthology
K04859  
voltage-dependent calcium channel alpha-2/delta-2
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    300992 (Cacna2d2)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    300992 (Cacna2d2)
  Circulatory system
   04260 Cardiac muscle contraction
    300992 (Cacna2d2)
   04261 Adrenergic signaling in cardiomyocytes
    300992 (Cacna2d2)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    300992 (Cacna2d2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    300992 (Cacna2d2)
   05414 Dilated cardiomyopathy (DCM)
    300992 (Cacna2d2)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   300992 (Cacna2d2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
8q32
AA seq 1157 aa AA seqDB search
MAVPARTCGASWPGPVRTARPWPGRGPRPCPDPRGPASGPARPLLLLLPPLLLLPLLTAP
GASAYSFPQQHTMQHWARRLEQEIDGVMRIFGGVQQLREIYKDNRNLFDVQENEPQKLVE
KVAGDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIMYYDAKADAELDDPESED
MERGSKTSALRLDFIEEPNFKNKVNYSYTAVQIPTDIYKGSTVILNELNWTEALENVFIE
NRRQDPTLLWQVFGSATGVTRYYPATPWRAPKKIDLYDVRRRPWYIQGASSPKDMVIIVD
VSGSVSGLTLKLMKTSVCEMLDTLSDDDYVNVASFNEKAQPVSCFTHLVQANVRNKKVFK
EAVQGMVAKGTTGYKAGFEYAFDQLQNSNITRANCNKMIMMFTDGGEDRVQDVFEKYNWP
NRTVRVFTFSVGQHNYDVTPLQWMACTNKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAG
KDAKQVQWTNVYEDALGLGLVVTGTLPVFNLTQDGPGDKKNQLILGVMGIDVALNDIKRL
TPNYTLGANGYVFAIDLNGYVLLHPNLKPQITNFREPVTLDFLDAELEDENKEEIRRSMI
DGDKGHKQIRTLVKSLDERYIDEVIRNYTWVPIRSTNYSLGLVLPPYSTYYLQANLSDQI
LQVKLPISKLKDFEFLLPSSFESEGHVFIAPREYCKDLNASDNNTEFLKNFIELMEKVTP
DSKQCNNFLLHNLILDTGITQQLVERVWRDQDLNTYSLLAVFAATDGGITRVFPNKAAED
WTENPEPFNASFYRRSLDNRGYIFKPPHQDSLLRPLELENDTVGVLVSTAVELSLGRRTL
RPAVVGVKLDLEAWAEKFKVLASNRTHQDQPQKQCGPSSHCEMDCEVNNEDLLCVLIDDG
GFLVLSNQNHQWDQVGRFFSEVDANLMLALYNNSFYTRKESYDYQAACAPQPPGNLGAAP
RGVFVPTIADFLNLAWWTSAAAWSLFQQLLYGLIYHSWFQADPAEAEGSPETRESSCVMK
QTQYYFGSVNASYNAIIDCGNCSRLFHAQRLTNTNLLFVVAEKPLCSQCEVGRLLQKETH
CPADGPEQCELVQRPRYRTGPHICFDYNATEDTSDCGRGASFPPSLGVLVSLQLLLLLGL
PPRPQPQIHSFTPSRRL
NT seq 3474 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgccggctcggacctgcggcgcttcttggcccggcccggtgcggaccgctcgc
ccctggcccggtcgcggtccccggccctgccctgacccccggggcccagcgtccgggccc
gcacgcccgctcttgctactgctgccgcctctgctgcttttaccgctgctcaccgccccc
ggcgcctctgcctacagcttcccccagcagcacacgatgcagcactgggcccggcgcctg
gagcaggagattgacggtgtgatgcggatttttggaggcgtgcagcagctccgagagatc
tacaaggacaatcggaacctgtttgatgtgcaggagaatgaaccacagaaactagtggag
aaggtggcaggggacattgagagcctgctggacagaaaggtccaggccttgaagagactg
gctgacgctgcagagaatttccagaaagcccaccgctggcaagacaacatcaaggaggaa
gacatcatgtactatgacgccaaggctgacgccgagctggatgatcctgagagtgaggat
atggagaggggatccaagaccagcgccttaaggctggacttcatcgaggagccaaacttc
aagaacaaagtcaactattcatacacggcggtgcagatccccacagatatctacaaaggc
tctaccgtcatcctcaatgagcttaactggacggaggccctggagaatgtcttcattgag
aaccgtaggcaagaccctacactgttgtggcaagtcttcggcagtgccacgggagtcacc
cgctattacccagccacaccgtggcgagcccccaagaagattgacctgtacgatgtcaga
agacgaccctggtatatacagggggcctcatcacccaaggacatggtcatcattgtggat
gtgagtggcagtgtgagcggcctgacgctgaagctgatgaagacgtctgtctgtgagatg
ctagacacactctccgatgatgactatgtgaatgtggcctcattcaacgagaaggcgcag
cctgtgtcttgcttcacacacctggtgcaggccaatgtgcggaacaagaaggtgttcaag
gaagctgtgcagggcatggtggccaagggcaccacaggctacaaggctggctttgagtat
gcctttgaccagctacagaattccaacatcacccgtgctaactgcaataagatgatcatg
atgttcacggacgggggagaggatcgcgtgcaggacgtctttgaaaagtataattggccc
aatcggacggtacgcgtcttcacgttctccgtaggacagcataactatgatgtcacaccc
ctgcagtggatggcttgtactaacaaaggttactattttgagatcccttccatcggagcc
atccgcatcaacacacaggaatacctggatgtgctgggtaggcccatggtcctggcaggc
aaggacgccaagcaagtgcaatggacaaacgtgtatgaagatgcgctggggctggggttg
gtggtaacagggactctccctgttttcaacctgacacaggatggccctggggacaagaag
aaccagctaatcctgggtgtcatgggcatagatgtggccctgaatgacatcaaaaggctg
actcccaactacacacttggcgccaatggctacgtgttcgccatcgacctgaatggctat
gtgttgctacatcccaatctcaagccccagattaccaacttccgggagcctgtgaccttg
gacttcctggatgcagagctggaagatgagaacaaggaggagatccgtcgtagtatgatt
gacggagacaaaggccacaagcagatcagaaccttggtcaaatccctggatgagaggtac
atagatgaagtgattcggaactacacctgggtgcctataaggagtaccaactacagcctg
gggctggtgctcccaccctacagcacctactacctccaagccaacctcagcgaccagatc
ctgcaggtcaagttgccaatcagcaaactgaaggattttgagttcctgctccccagcagc
tttgagtctgaaggacatgttttcattgctcccagagagtattgcaaggatttgaatgcc
tcagacaacaacaccgagttcctgaaaaacttcattgagctcatggagaaagtgactccg
gactccaagcagtgcaataacttccttctgcataacttgattttggacacgggcattacg
cagcagttagtggaacgcgtctggcgggaccaagatctcaacacgtacagcctgctagct
gtatttgctgccactgacggtggcatcacacgtgtcttcccgaacaaggcagctgaagac
tggacagaaaaccctgaacccttcaatgccagcttctaccgccgcagcctggataaccgt
ggttatatcttcaagcccccgcaccaggactccctgttaaggccactggagctggagaat
gacacagtaggcgtcctcgtcagcacagctgtagagctcagtctgggtcgccgcacactg
aggccagcagtggtgggtgtcaaactggacctagaggcttgggctgaaaagttcaaggtg
cttgccagcaaccgtacccatcaggaccaacctcagaagcagtgcggccccagcagccac
tgtgagatggactgcgaggtaaacaacgaggacctactctgtgtcctcattgatgacggg
ggattcctggtgctgtcaaaccaaaaccaccagtgggaccaggttggcaggttcttcagt
gaggtggatgccaacctgatgctggcactgtacaataactccttctacaccagaaaggag
tcctatgactatcaggcagcttgtgcccctcagcctcctggcaacctgggtgctgcaccc
aggggtgtctttgtgcccaccattgcagatttccttaacttggcctggtggacctctgct
gccgcctggtccttattccagcaactactttatggtctcatctatcacagctggttccag
gcagacccggcagaagccgagggcagccccgagacgcgcgagagcagctgcgtcatgaaa
caaacccagtactacttcggctcggtgaacgcgtcctataacgccatcatcgactgcgga
aactgcagcaggctgttccacgcgcagagactgaccaacaccaaccttctgttcgtggtg
gcggagaagccgctgtgcagccagtgcgaggtcggccggctgctacaaaaggagacacac
tgcccagcggacggcccggagcagtgtgagctggtgcagagaccgcgataccgaacaggc
ccgcacatctgttttgactacaatgcgacggaagatacctcagactgtggccgcggagcc
tccttccctccgtcgctgggcgtcttggtttccctgcagctgttgctcctcctaggcctg
ccacctcggccgcagcctcaaatccattccttcacgccctctcgccgcctctga

DBGET integrated database retrieval system