KEGG   Rattus norvegicus (rat): 301024Help
Entry
301024            CDS       T01003                                 

Gene name
Scap
Definition
(RefSeq) SREBF chaperone
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
Ensembl: 
UniProt: 
Position
8q32
AA seq 1276 aa AA seqDB search
MTLTERLREKISQAFYNHGLLCASYPIPIILFTGLCILACCYPLLKLPLPGTGPVEFSTP
VKGYSPPPADSDHKQGEPSEQPEWYVGAPVAYIQQIFVKSSVSPWHRNLLAVDVFRSPLS
RAFQLVEEIRNHVLRDSSGTKSLEEVCLQVTDLLPGLRKLRSLLPEHGCLLLSPGNFWQN
DWERFHADPDIIGTIHQHEPKTLQTSATLKDLLFGVPGKYSGVSLYTRKRMVSYTITLVF
QRYHAKFLSSLRARLMLLHPSPNCSLRAENLVHVHFKEEIGIAELIPLVTTYIILFAYIY
FSTRKIDMVKSKWGLALAAVVTVLSSLLMSVGLCTLFGLTPTLNGGEIFPYLVVVIGLEN
VLVLTKSVVSTPVDLEVKLRIAQGLSSESWSIMKNVATELGIILIGYFTLVPAIQEFCLF
AVVGLVSDFFLQMLFFTTVLSIDIRRMELADLNKRLPPESCLPSAKPVGRPARYERQLAV
RPSTPHTITLQPSSFRNLRLPKRLRVIYFLARTRLAQRLIMAGTVVWIGILVYTDPAGLR
TYLAAQVTEQSPLGEGSLGPMPVPSGVLPASHPDPAFSIFPPDAPKLPENQTLPGELPEH
AVPAEGVQDSRAPEVTWGPEDEELWRKLSFRHWPTLFNYYNITLAKRYISLLPVIPVTLH
LNPREALEGRHPQDGRTAWAPPEPLPAGLWETGPKGPGGTQTHGDITLYKVAALGLAAGI
VLVLLLLCLYRVLCPRNYGQPGGGAGRRRRGELPCDDYGYAPPETEIVPLVLRGHLMDIE
CLASDGMLLVSCCLAGQVCVWDAQTGDCLTRIPRPGPRRDSCGGGAFEAQENWERLSDGG
KASPEEPGDSPPLRRRPRGPPPPSLFGDQPDLTCLIDTNFSVQLPPEPTQPEPRHRAGCG
RSRDSGYDFSRLVQRVYQEEGLAAVHMSALRPPSPGPPLPQASQEEGTAPEKGSPPLAWA
PSTAGSIWSLELQGSLIVVGRSSGRLEVWDAIEGVLCCSNEEISSGITALVFLDRRIVAA
RLNGSLDFFSLETHTSLSPLQFRGTPGRGSSPSSPVYSSSNTVACHLTHTVPCAHQKPIT
ALRAAAGRLVTGSQDHTLRVFRLEDSCCLFTLQGHSGAITTVYIDQTMVLASGGQDGAIC
LWDVLTGSRVSHTFAHRGDVTSLTCTTSCVISSGLDDFINIWDRSTGIKLYSIQQDLGCG
ASLGVISDNLLVTGGQGCVSFWDLNYGDLLQTVYLGKNSEAQPARQILVLDNAAIVCNFG
SELSLVYVPSVLEKLD
NT seq 3831 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgactgaaaggcttcgtgagaagatatctcaggcgttctacaaccatgggctg
ctctgcgcatcctaccccattcccatcatcctcttcacaggactctgcatcctagcctgc
tgctacccgctgctgaagcttcccttgcctggaacgggacccgtggaattctccacgcct
gtgaagggttactcgcccccgcctgcggactctgaccacaaacaaggagagcccagtgag
cagccagagtggtatgtgggtgcccccgtggcatacatccagcagatattcgtgaagtca
tcagtgtctccctggcacagaaaccttctggcagtagatgtgttccggtcacctctgtcc
cgagcattccaactggtggaagagatccggaaccatgtgctgagagacagctcagggacc
aagagcctggaggaagtttgcctgcaggtgacagacctgctgccaggcctcaggaaactc
cggagcctacttcccgaacatggctgcctgctgctgtcacctgggaacttctggcagaat
gactgggaaagattccatgctgaccctgacatcattggaaccatccatcagcatgagcct
aaaaccctacagacatcagccacactcaaagacttgctgttcggtgttcctgggaagtac
agtggggtcagcctctacacgaggaagaggatggtctcatacaccatcaccctggtcttc
cagcgctaccatgccaagtttctgagcagcctccgtgcccggctcatgcttctgcacccc
agccccaactgcagcctccgagcagagaacctggtgcatgtgcacttcaaagaggagatt
ggcattgccgagctcatccccctcgtgaccacctacatcatcctgtttgcctacatctac
ttctccacacgcaagatcgacatggtcaagtccaagtggggcctcgccctggcagccgtg
gtcacagtgcttagctcgctgctcatgtctgtggggctctgcactctcttcggcctgacg
cccacactcaatggcggcgagattttcccatatctggtggtggttattgggctagagaat
gtgttggtgctcaccaagtcagtggtatcaactccagtggaccttgaggtgaagcttcga
attgcacaaggcttaagcagtgagagctggtccatcatgaagaacgtagcaactgaactg
ggcatcatcctcattggctacttcacccttgtgcctgccatccaagagttctgcctcttt
gctgtggtgggcctggtgtctgacttcttcctccagatgctgttcttcaccaccgtgctg
tccatcgacattcgccggatggagctagcagacctgaacaagcggctgccccctgagtcc
tgcctgccctcagccaagcctgtggggaggccagcccgatatgagagacagctagctgta
cggccgtccacaccacacaccatcacattgcaaccatcttccttccgaaacctgcggctt
cccaaaaggctgcgtgtcatctacttcctggcccgcactcgcctggcacagcgcctcatc
atggctggtacagttgtctggattggcatcctggtatatacagacccggcagggctgcgc
acctacctcgctgcccaggtgacagaacagagcccactgggtgagggttccctggggccc
atgcctgtgcctagtggagtgctgcctgccagccacccggaccctgccttctccatcttc
ccacctgatgctcctaaactgccagagaaccagacgttgccaggtgagctgcctgagcat
gccgttccagcagagggcgtccaggacagccgagccccagaggtgacttgggggcccgag
gatgaggagctgtggaggaaattgtccttccgccactggcccacactcttcaactactat
aatatcacactggccaaaaggtacatcagcctgctgcctgtcatccctgtcacactacac
ctgaatccacgggaggctctggaggggcgacaccctcaggatggccgcactgcctgggcc
ccaccagagcctttgcctgctggcctgtgggagaccggacctaaggggccaggtggaaca
cagacccatggcgacattaccttgtacaaggtggctgcacttggcctggcagcgggcatt
gtcctagtgctgctgctgctctgcctctaccgggtgctctgcccgcgaaactacgggcag
ccgggtggtggtgcgggcaggcggaggcgcggagagctgccttgcgatgactatggctac
gcaccgcctgagacggagatagtgccgctggtgctgcgagggcacctcatggacatcgag
tgtctggctagcgatgggatgctcctggtgagctgctgcctggctggccaagtctgcgtg
tgggatgcacagaccggggactgcctcactcgcatcccgcgccctgggccacgccgggac
agctgcggaggcggagcttttgaagctcaggagaactgggaaagactgtctgatgggggc
aaagctagcccggaagagcctggcgacagccctccgctgcgacgccgccctcgagggcct
ccaccgccttccctctttggggaccagccagacctcacctgcttaatcgacaccaacttc
tcagtgcagctgcccccagagcccactcagcccgagcctcggcaccgggcgggctgtggc
cgctctagagactctggttacgacttcagccgtctggtgcagcgtgtgtaccaagaggaa
ggcctggctgctgtgcacatgtcggccctgcgcccaccctccccgggacctcccctgccc
caggcctctcaagaagaggggactgctcccgagaagggctccccccctctggcctgggcc
cccagcacagccggttccatctggagcttagagttgcaaggcagtctcatcgtggttggg
cgaagcagcggccggctggaggtgtgggatgccattgagggcgtgctctgctgcagcaat
gaggagatctcctcaggcatcacagcccttgtcttcttagacaggaggattgtagctgct
cggctcaacggttccctcgatttcttttccttggagacccacacttccctcagccccctg
cagttcagagggaccccagggagaggcagttctccttcctcgcctgtgtacagcagcagc
aacactgtggcctgtcacctgacccacacagtcccctgtgcacaccagaaacccatcaca
gccctgagagcagcagcggggcgcctggtgacagggagccaagaccatactctgagagtc
ttccgactggaggattcgtgttgcctctttaccctgcagggccactcgggggcaatcaca
actgtgtacattgatcagaccatggtattggccagtggaggacaagatggagccatctgc
ctgtgggatgtactaacaggcagccgggtcagccatacatttgctcaccgtggagatgtc
acctccctcacctgtaccacttcctgtgttatcagtagtggcctggatgacttcatcaac
atctgggaccgaagcacaggcatcaagctgtactccattcagcaggacctgggctgtggt
gcaagcttgggtgtcatctctgataaccttctggtgaccggcggccagggatgtgtctcc
ttttgggacctaaactatggggacctgttacagacagtctacttgggaaagaacagtgaa
gcccagcctgcccggcagattttggtgctggacaatgctgccattgtctgcaactttggc
agtgagctcagcctagtgtatgtgccctctgtgctggagaaactggactga

DBGET integrated database retrieval system