KEGG   Rattus norvegicus (rat): 301164Help
Entry
301164            CDS       T01003                                 

Gene name
Kat2b, Pcaf
Definition
K(lysine) acetyltransferase 2B
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    301164 (Kat2b)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    301164 (Kat2b)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    301164 (Kat2b)
  Infectious diseases
   05166 HTLV-I infection
    301164 (Kat2b)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     301164 (Kat2b)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     301164 (Kat2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Position
9q11
AA seq 674 aa AA seqDB search
MNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRGKPMVEGSLEKKPPFE
KPSIEQGVNNFVQYKFSHLPSKERQTTIELAKMFLNRINYWHLEAPSQRRLRSPNDDISG
YKENYTRWLCYCNVPQFCDSLPRYETTKVFGRTLLRSVFTIMRRQLLEQARQEKDKLPLE
KRTLILTHFPKFLSMLEEEVYSQNSPIWDQDFLSASSRTSPLGIQTVISPPVTGTALFSS
NSTSHEQINGGRTSPGCRSSSGLEANPGEKRKMNNSHAPEEAKRSRVMGDIPVELISEVM
STITDPAGMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKMLMWLVGL
QNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTS
NEQVKGYGTHLMNHLKEYHIKHEILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIK
DYEGATLMGCELNPQIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQI
PIESIPGIRETGWKPSGKEKSKEPKDPEQLYSTLKNILQQVKSHQSAWPFMEPVKRTEAP
GYYEVIRFPMDLKTMSERLRNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCASVLEK
FFFSKIKEAGLMDK
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgaacagactcctgggaattgtgttggatgtggagtacctctttacctgcgtccacaaa
gaagaagatgcagataccaaacaagtttatttctacctgttcaagctcttgagaaagtca
attttacaaagaggaaagcctatggttgaaggctccttggagaagaagccaccatttgaa
aagcccagtattgaacagggtgtgaacaactttgtccagtacaagtttagtcacttgcca
tcaaaggagaggcagacaacaatcgagctggccaagatgtttctgaaccgcatcaactac
tggcatctggaggctccatctcagcggagactacggtctcccaatgatgacatctctgga
tacaaggaaaactatacaaggtggttgtgctactgcaacgtgccgcagttctgtgacagc
ttacctcggtatgaaactacgaaggtgttcgggagaacactgcttcgctccgtcttcacc
atcatgagacgacagctcttagaacaagccagacaggaaaaggacaaactgcctcttgag
aaacgcacgctaatcctcacgcatttcccaaagtttctgtccatgttggaagaagaagtg
tatagtcaaaactcgcctatctgggatcaggattttctctcagcttcttccagaaccagc
ccactaggaatccaaacagtgatcagtcctcctgttactgggacagcattattcagttca
aattccacttcccatgagcagatcaatggagggagaacaagtcctggatgcagaagctct
tctgggcttgaagcaaacccaggagaaaagaggaaaatgaacaactctcatgctccagag
gaggccaagcgatctcgagtgatgggggatattcctgtggaactgatcagtgaagttatg
tctaccatcacagaccctgcagggatgcttggaccagagaccaattttctgtcagcacat
tcggccagagatgaggccgcaaggctggaagaacgcaggggcgtcattgaattccacgtg
gtgggcaattccctgaaccagaaaccaaataagaagatgctgatgtggctggtgggccta
cagaatgtgttttcccaccagcttccccgcatgcccaaagagtacatcacacggcttgtc
tttgacccgaaacacaaaacccttgctttaattaaagatggccgtgtcattggtggtatc
tgtttccggatgtttccatcccagggatttacagagattgttttctgtgcggtaacctca
aatgaacaggtcaagggctatggaacccacttgatgaaccatctcaaagaatatcacata
aagcacgagatcctcaacttcctcacatacgcagatgagtatgccatcggctacttcaag
aagcagggtttctccaaagaaatcaaaatacctaaaaccaaatatgttggctacatcaag
gattatgaaggagccactttgatggggtgtgaactgaaccctcagatcccatacacagag
ttctcggtcatcattaaaaagcagaaggagatcattaaaaagcttattgaaaggaaacaa
gctcagatacgaaaagtctaccctggactttcatgtttcaaagatggagttcggcagatt
cctatagaaagcattcctggaatcagagagacaggctggaaaccaagtggaaaagagaaa
agtaaagagcccaaagaccctgagcagctttacagcacgctcaagaacatcctgcagcag
gtgaagagccatcaaagcgcttggcccttcatggaaccagtgaagcgaacagaagctccg
ggatattatgaagttataaggttccccatggatctgaaaaccatgagtgaacgcctcagg
aacaggtactatgtgtctaagaagttattcatggcggacttacagcgagtgttcaccaac
tgcaaggagtacaacccccccgagagcgagtactacaagtgcgccagcgtcctggagaag
ttcttcttcagtaaaattaaggaagcaggcttgatggacaagtga

DBGET integrated database retrieval system