KEGG   Rattus norvegicus (rat): 301384Help
Entry
301384            CDS       T01003                                 

Gene name
Hibch
Definition
3-hydroxyisobutyryl-CoA hydrolase (EC:3.1.2.4)
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    301384 (Hibch)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    301384 (Hibch)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    301384 (Hibch)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    301384 (Hibch)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     301384 (Hibch)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
9q22
AA seq 311 aa AA seqDB search
MGQQFVWRLQSRFSSIRRASVILQHLRMSKHTETAEVLLERRGCAGVITLNRPKLLNALS
LNMIRQIYPQLKKWERDPDTFLIIIKGAGGKAFCAGGDIKALSEAKKAGQTLSQDLFREE
YILNNAIASCQKPYVALIDGITMGGGVGLSVHGQFRVATERSLFAMPETGIGLFPDVGGG
YFLPRLQGKLGYFLALTGFRLKGRDVHRAGIATHFVDSEKLHVLEEELLALKSPSAEDVA
GVLESYHAKSKMGQDKSIIFEEHMDKINSCFSANTVEQILENLRQDGSPFAMEQIKFSLT
KTRLQNGNQLI
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggggcagcagtttgtgtggcggctccagtcgaggttcagctcaatcagaagagccagt
gttattctgcaacatctgagaatgtccaagcacacagagactgcagaagtgctgctggag
aggagaggctgtgcaggggtcataacgctcaacagacccaagttactcaacgctctgagt
ctgaatatgatccggcagatctatccgcagctaaagaagtgggaacgagacccagataca
ttcctgatcatcataaagggagctggaggaaaggccttctgtgctggaggggacatcaaa
gcactctcagaagctaaaaaagcagggcagactttgagtcaagatttattcagagaagaa
tatatcctgaacaatgccattgcgtcttgtcagaaaccgtatgttgcccttattgatgga
atcacaatgggtgggggagttggtctttcagtccatggtcaattccgagtggctacagaa
agatctctctttgctatgccagaaacgggaataggactgtttcctgatgtgggcggaggt
tatttcttgccaagacttcaaggaaaactgggttacttccttgcactgacaggattcaga
ctaaaaggaagagatgtgcacagagcgggaatcgccacacactttgtagattcagaaaag
ttgcatgtactggaggaggagttgttagccttaaagtccccttcagctgaggatgttgct
ggtgtcttagaaagctatcatgccaagtccaagatgggtcaagacaagtctatcatattt
gaggaacacatggacaaaataaacagttgtttttcagccaatactgtggaacagattctt
gaaaacttacggcaagatggttcaccttttgctatggaacagattaagttctcattgaca
aagaccagactccaaaatggaaaccagctgatctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system