KEGG   Rattus norvegicus (rat): 301434Help
Entry
301434            CDS       T01003                                 

Gene name
Clk1
Definition
CDC-like kinase 1 (EC:2.7.12.1)
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Legionellosis
Class
Human Diseases; Infectious diseases; Legionellosis [PATH:rno05134]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
9q31
AA seq 483 aa AA seqDB search
MRHSKRTYCPDWDERDWDYGTWRSSSSHKRRKRSHSSARDYKRCKYNHSKTTDSYYLESR
SIHEKAYHSRRYVDEYRNDYMTYEPGYPYGEPGSRYQNHSSKSSGRSGRSSYKSKHRSHH
HTSHRRSHGKSHRRKRSRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECIDH
KVGGRHVAVKIVKNVDRYCEAAQSEIQVLEHLNATDPHSTFRCVQMLEWFEHRGHICIVF
ELLGLSTYDFIKENSFLPFRMDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVKSDY
TEAYNPKMKRDERTIVNPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCD
VWSIGCILIEYYLGFTVFPTHDSREHLAMMERILGPLPKHMIEKTRKRTYFHHDRLDWDE
HSSAGRYVSRRCKPLKEFMLSQDAEHELLFDLIGKMLEYDPAKRITLKEALKHPFFYPLK
KHT
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagacattcaaagagaacttactgtcctgactgggatgaaagagattgggattatgga
acatggagaagcagcagcagtcataaaagaaggaagagatcacatagcagtgcccgtgat
tataagcgatgcaaatacaatcactccaaaacaacggacagctattatctggaaagtaga
tccatacatgagaaagcctatcacagccgacgctatgttgatgaatacaggaatgactac
atgacctacgagccagggtatccctatggagaacctggaagcagataccagaatcatagt
agcaagtcctctggtaggagtggaagaagcagttacaaaagcaaacataggagtcaccac
cacacgtcacatcgtcgttcacatgggaagagtcaccgaaggaaaagatcgaggagtgta
gaggatgatgaggagggtcacctgatctgtcagagtggagacgtactaagtgcaagatat
gaaattgttgatactttaggtgaaggtgcttttggaaaagtggtggagtgtatcgatcat
aaagtgggaggtagacatgtagcggtaaaaatagttaaaaatgtggatagatactgtgaa
gctgctcaatcggaaatacaagttttggaacacttaaatgcaacagacccccatagtact
ttccgttgtgtccagatgttggaatggtttgagcaccgaggtcacatttgcattgtgttt
gaacttctggggcttagtacttacgatttcattaaggaaaacagctttctgccgtttcga
atggatcatatcaggaagatggcatatcaaatatgcaaatctgtaaactttttgcatagt
aataaattgactcacacagacttgaagcctgaaaacatcttatttgtgaagtctgactac
acagaggcttataatcccaaaatgaaacgtgatgaacgcactatagtaaatcccgatatt
aaagtggtggactttgggagtgcaacatatgatgacgaacatcacagcacattggtatct
acaagacattacagagcaccagaagtcattctagccctagggtggtcacaaccatgtgat
gtctggagtataggatgtattcttatcgagtattatcttggatttacagtttttccgact
catgatagcagggaacatttagcaatgatggaaaggattcttggaccactgccaaagcac
atgattgagaaaaccaggaaacgcacatacttccatcacgatcgattggattgggatgag
cacagttctgctggcagatatgtttctcggcgctgtaagcctctgaaggagtttatgctg
tctcaggatgccgagcatgagcttctctttgacctcattgggaaaatgttggagtatgat
ccagccaaaagaatcactctcaaagaagccctaaagcatcctttcttttacccgcttaaa
aagcatacatga

DBGET integrated database retrieval system