KEGG   Rattus norvegicus (rat): 301595Help
Entry
301595            CDS       T01003                                 

Gene name
Ugt1a8, UDPGT_1-8, Ugt1, Ugt1a9
Definition
UDP glycosyltransferase 1 family, polypeptide A8 (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    301595 (Ugt1a8)
   00053 Ascorbate and aldarate metabolism
    301595 (Ugt1a8)
   00500 Starch and sucrose metabolism
    301595 (Ugt1a8)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    301595 (Ugt1a8)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    301595 (Ugt1a8)
   00860 Porphyrin and chlorophyll metabolism
    301595 (Ugt1a8)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    301595 (Ugt1a8)
   00982 Drug metabolism - cytochrome P450
    301595 (Ugt1a8)
   00983 Drug metabolism - other enzymes
    301595 (Ugt1a8)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    301595 (Ugt1a8)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     301595 (Ugt1a8)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   301595 (Ugt1a8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
9q35
AA seq 530 aa AA seqDB search
MAPSGCPPSLPLCVCLFLASGFAQAGRLLVVPMDGSHWFTMQMIVEKLSHRGHEVVVVIP
EVSWHMGKSLNFTVKTYSVSYTLEDLNYHFKFFAHNQWKTQEVGMFSLLKHSGKGFFELL
FSHCRSLFKDKKLVEYLKQSSFDAVFLDPFDVCGLILAKYFSLPSVVFSGGIFCHYLDEG
AQCPSPPSYVPRILSKFTDTMTFKERVWNHLSYMKERAFCPYFFKTAVEIASEVLQTPVT
MRDLFSPVSIWMFRTDFVLEFPRPVMPNMVYIGGINCHQGKPLSKEFEAYVNASGEHGIV
VFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLGH
PKARAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDL
ENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTW
YQYHSLDVIGFLLAIVLTVVFIVYKSCAYGCRKCFGGKGRVKKSHKSKTH
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggctccttcaggctgtccaccctcccttcctctgtgtgtttgtctgttcctggcctct
ggctttgcccaggcaggcaggctgctggtagtgcccatggacgggagccactggttcacc
atgcagatgattgtggagaaactgagtcacagagggcatgaggtggtggtagtcatccca
gaggtgagttggcacatgggaaagtcgctgaattttaccgtgaaaacttactcagtttct
tacactctggaagatttaaactaccacttcaagttttttgctcacaaccaatggaaaact
caagaagtagggatgttttctctactgaagcattcaggcaaaggtttcttcgaattactg
ttttcacactgtaggagtttgtttaaggacaagaagttagtggagtacttgaagcagagt
tcgtttgatgctgtgtttctggatccttttgatgtgtgtggcttaattcttgccaagtac
ttttctctcccgtccgtggtcttcagcgggggaatattttgccactaccttgatgagggt
gcccagtgccccagtcctccttcttatgttcccagaattctctcaaaattcacagacacc
atgactttcaaggagagagtgtggaaccatctctcctacatgaaggagcgtgcattttgc
ccctactttttcaaaactgccgtagaaattgcctctgaagttctccagaccccggtgact
atgagagacctcttcagcccagtgtccatttggatgtttcgaactgactttgtgctggag
ttccccagacctgtgatgcccaacatggtctacattggtgggatcaactgccaccagggg
aagccactttccaaggaatttgaagcctatgtcaacgcctccggagaacatggcatcgtg
gttttctctttgggatccatggtctcagagattccagagaagaaagcgatggaaattgct
gaggctttgggcagaattcctcagacggtcctgtggcgctacaccggaactagaccatcg
aaccttgcaaagaacactattcttgtcaaatggctaccccaaaacgatctgcttggtcat
ccaaaggctcgggcgttcatcacacactccggttcccatggtatttatgaaggaatatgc
aatggggttccaatggtgatgatgcccttgtttggtgatcagatggacaacgccaagcgc
atggaaactcggggagctggggtgaccctgaatgtcctggaaatgactgccgatgatttg
gaaaacgcccttaaaactgtcatcaataacaagagttacaaggagaacatcatgcgcctc
tccagccttcacaaggaccgtcctatcgagcctctggacctggctgtgttctgggtggag
tacgtgatgaggcacaagggggcgccacacctgcgccccgccgcccacgacctcacctgg
taccagtaccactccttggacgtgattggctttctcctggccatcgtgttgacggtggtc
ttcattgtctataaaagttgtgcctatggctgccggaaatgctttgggggaaagggtcga
gtgaagaaatcacacaaatccaagacccactga

DBGET integrated database retrieval system