KEGG   Rattus norvegicus (rat): 302553Help
Entry
302553            CDS       T01003                                 

Gene name
Suv39h1, RGD1565028
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1 (Drosophila) (EC:2.1.1.43)
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
rno  Rattus norvegicus (rat)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    302553 (Suv39h1)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     302553 (Suv39h1)
Chromosome [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     302553 (Suv39h1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    302553 (Suv39h1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
Xq13
AA seq 413 aa AA seqDB search
MGEPATLGCSVCCKSSWNQLQDLCRLAKLSCPALGVSKKNLYDFEVEYLCDYKKIREQEY
YLVKWRGYPDSENTWEPRQNLKCVRILKQFHKDLERELVRRHRRSKPPRHLDPNLANYLV
QKAKQRRALQRWEQELNAKRSHLGRITVENEVDLDGPPRSFVYINEYRVGEGITLNQVAV
GCECQDCLLAPTGGCCPGASLHKFAYNDQGQVRLKAGQPIYECNSRCCCGYDCPNRVVQK
GIRYNLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLF
DLDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIWAGE
ELTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTTACRKYLF
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgggggaaccggcgactctaggttgcagtgtgtgctgtaaatcttcctggaatcagctg
caggatctgtgccgactagccaagctttcttgtcctgcccttggtgtttctaagaagaat
ctgtatgactttgaagttgaatacctgtgtgattataagaagatccgtgagcaggagtat
tacctggttaaatggcgtgggtatcctgactcagagaacacctgggagccacggcagaat
ctcaaatgtgtgcgcattcttaagcagttccacaaggacttagaaagagagcttgtccgg
cgacaccgccggtcaaagccacccaggcatctggacccaaacttagccaattacctggtg
cagaaggccaagcagaggcgggcactgcagcgttgggaacaagagctcaatgccaagcgc
agccatctggggcggatcactgtggagaatgaggtagacctggatggccctccaaggtcc
tttgtctatatcaatgagtatcgagttggtgagggcatcaccctcaaccaggtagctgtt
ggctgtgagtgccaggactgtctgttggcacccactggaggctgttgccctggagcatcc
ctgcacaagtttgcctacaatgaccaaggccaggtgcgactgaaagctgggcagcccatc
tacgagtgcaactctcgctgttgctgtggctatgactgcccaaaccgtgtagtccagaaa
ggcatccgctacaacctctgcatcttccgcactgatgatggccgaggctggggtgtccgc
acgctggaaaagatccgcaaaaatagctttgttatggagtatgtgggagagattattacc
tcagaggaggcagagcggaggggccagatctacgaccgccagggcgccacctacctcttt
gacctggactacgtggaggacgtatataccgtggatgccgcctattatggcaacatctct
cactttgtcaaccatagttgtgatcccaacctgcaggtgtacaacgtattcatagacaac
cttgatgagcgactaccccgcatcgcattctttgccacaagaaccatctgggcgggcgag
gagctcacctttgattacaacatgcaagtggaccccgtggacatggagagtacccgaatg
gactccaactttggcctggcagggctccccggctcccccaagaaacgggtccgtattgaa
tgcaaatgtgggacaacagcttgccgaaaatacctcttctag

DBGET integrated database retrieval system