KEGG   Rattus norvegicus (rat): 302553Help
Entry
302553            CDS       T01003                                 

Gene name
Suv39h1, RGD1565028
Definition
suppressor of variegation 3-9 homolog 1 (Drosophila) (EC:2.1.1.43)
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
rno  Rattus norvegicus (rat)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    302553 (Suv39h1)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     302553 (Suv39h1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
Xq13
AA seq 413 aa AA seqDB search
MGEPATLGCSVCCKSSWNQLQDLCRLAKLSCPALGVSKKNLYDFEVEYLCDYKKIREQEY
YLVKWRGYPDSENTWEPRQNLKCVRILKQFHKDLERELVRRHRRSKPPRHLDPNLANYLV
QKAKQRRALQRWEQELNAKRSHLGRITVENEVDLDGPPRSFVYINEYRVGEGITLNQVAV
GCECQDCLLAPTGGCCPGASLHKFAYNDQGQVRLKAGQPIYECNSRCCCGYDCPNRVVQK
GIRYNLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLF
DLDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIWAGE
ELTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTTACRKYLF
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgggggaaccggcgactctaggttgcagtgtgtgctgtaaatcttcctggaatcagctg
caggatctgtgccgactagccaagctttcttgtcctgcccttggtgtttctaagaagaat
ctgtatgactttgaagttgaatacctgtgtgattataagaagatccgtgagcaggagtat
tacctggttaaatggcgtgggtatcctgactcagagaacacctgggagccacggcagaat
ctcaaatgtgtgcgcattcttaagcagttccacaaggacttagaaagagagcttgtccgg
cgacaccgccggtcaaagccacccaggcatctggacccaaacttagccaattacctggtg
cagaaggccaagcagaggcgggcactgcagcgttgggaacaagagctcaatgccaagcgc
agccatctggggcggatcactgtggagaatgaggtagacctggatggccctccaaggtcc
tttgtctatatcaatgagtatcgagttggtgagggcatcaccctcaaccaggtagctgtt
ggctgtgagtgccaggactgtctgttggcacccactggaggctgttgccctggagcatcc
ctgcacaagtttgcctacaatgaccaaggccaggtgcgactgaaagctgggcagcccatc
tacgagtgcaactctcgctgttgctgtggctatgactgcccaaaccgtgtagtccagaaa
ggcatccgctacaacctctgcatcttccgcactgatgatggccgaggctggggtgtccgc
acgctggaaaagatccgcaaaaatagctttgttatggagtatgtgggagagattattacc
tcagaggaggcagagcggaggggccagatctacgaccgccagggcgccacctacctcttt
gacctggactacgtggaggacgtatataccgtggatgccgcctattatggcaacatctct
cactttgtcaaccatagttgtgatcccaacctgcaggtgtacaacgtattcatagacaac
cttgatgagcgactaccccgcatcgcattctttgccacaagaaccatctgggcgggcgag
gagctcacctttgattacaacatgcaagtggaccccgtggacatggagagtacccgaatg
gactccaactttggcctggcagggctccccggctcccccaagaaacgggtccgtattgaa
tgcaaatgtgggacaacagcttgccgaaaatacctcttctag

DBGET integrated database retrieval system