KEGG   Rattus norvegicus (rat): 302566Help
Entry
302566            CDS       T01003                                 

Gene name
Usp27x, RGD1564628, Usp27x-ps1
Definition
ubiquitin specific peptidase 27, X-linked
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     302566 (Usp27x)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   302566 (Usp27x)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     302566 (Usp27x)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
Xq13
AA seq 728 aa AA seqDB search
RKVEVEEKVEGKVEATGKVDATEKVETAGKVDATGKVEIAEGRGRGAELKLEPEPEPKPE
PEPEPEPEREPEPEPKPEPEPEPQPEPEPEPEPQPLPEPEPEPKREPEQEPKDENPAQSG
GGGSGDEVPPPTLPSDPPRPPDPSPRRSRAPRRRPRPRPQTRLRTPPQPRPRPPPRPRPR
RGPGGGCLDVDFAVGPPGCSHVNTFKVGENWRQELRVIYQCFVWCGTPETRKSKAKSCVC
HVCGTHLNRLHSCLSCVFFGCFTEKHIHEHAETKQHNLAVDLYYGGIYCFMCKDYVYDID
IEQIAKEEQGEALKLQASTSTEFSQQQCSVPSLGEKYPTWETTKPELELLGHNPRRRRIA
SSFTIGLRGLINLGNTCFMNCIVQALTHTPILRDFFLSDRHRCEMPSPELCLVCEMSSLF
RELYSGNPSPHVPYKLLHLVWIHARHLAGYRQQDAHEFLIAALDVLHRHCKGDDVGKVAS
NPNHCNCIIDQIFTGGLQSDVTCQACHGVSTTIDPCWDISLDLPGSCTSFWPMSPGRESS
LNGESHIPGVTTLTDCLRRFTRPEHLGSSAKIKCGSCQSYQESTKQLTMKKLPVVACFHF
KRFEHSAKQRRKITTYISFPLELDMTPFMASSKETRMNGQLQLPTNSGNNENKYSLFAVV
NHQGTLESGHYTSFIRHHRDQWFKCDDAVITKASIKDVLDSEGYLLFYHKQVLEHEPEKV
KEMTTQAY
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
aggaaggtggaggtggaggagaaggtggaggggaaggtggaggcgaccgggaaggtggac
gccaccgaaaaggtggagacagcaggaaaggtggacgccaccgggaaggtggagatcgcg
gagggtcggggccgcggggctgagctcaagctggagcccgagccggagcccaagccggag
ccggagccggagcccgagcccgagcgggagcccgagccggagcccaagccggagcccgag
ccggagccccagccggagcccgagccggagcccgaaccccagcccttaccggagcctgag
cctgagcctaagagggagcctgagcaggagccgaaggatgagaacccagcgcagagcggt
ggcggcggcagtggcgacgaggttcctccccccacccttccctccgatcctccgcggccc
ccagatccctccccgcgtcgcagtcgtgccccacgccgccgaccccggccccggccccag
actaggcttcgtaccccacctcagcctaggccacggcccccgccccggccccggccccgg
cgcggtcctgggggcggatgcttggatgtggattttgctgtggggccaccaggttgttcc
cacgtgaacacctttaaggtgggagagaactggaggcaggaattgcgggttatctaccag
tgcttcgtgtggtgtggaaccccagagaccaggaaaagcaaggcaaagtcgtgcgtctgc
catgtgtgtggcacccatttaaacagactccactcttgcctttcctgtgtcttctttggc
tgcttcacagagaaacacatccacgagcacgctgagacaaaacagcacaacttagcggta
gatctttattatggaggcatatactgcttcatgtgtaaagactatgtgtatgacatagac
attgagcaaattgccaaagaagagcaaggagaagccttgaaattacaagcgtccacctcg
acagagttttctcagcagcagtgttcagtgccgagccttggtgagaagtaccccacctgg
gaaaccaccaaacctgagttagaactgctggggcacaacccacggagaagaaggatcgcc
tccagctttaccatcggcttacgaggactaattaatcttggcaacacgtgttttatgaac
tgcatcgtccaggccctgacccacactccaatactgagagatttctttctctctgatagg
caccggtgtgaaatgcccagccctgagttgtgtctggtctgtgagatgtcttcgctcttt
cgggagctgtattctggaaacccatctcctcatgtgccctacaagttactgcacctggtg
tggattcatgctcgtcatctagcagggtacaggcaacaggatgcccatgagttcctcatc
gcggccctagatgtcctgcacaggcactgcaagggtgacgatgttggcaaggtggccagc
aaccccaaccactgtaactgcatcatagaccaaatcttcacaggtggcctgcagtccgat
gttacctgtcaagcctgccatggtgtctccaccactatagacccatgctgggacattagt
ctggacttgcctggctcttgtacatccttctggcccatgagtcctgggagggagagcagc
ttgaatggagaaagccacataccaggcgttaccaccctcacggactgcttgcggaggttt
acaaggccagagcacttaggcagtagtgccaaaatcaagtgtggtagttgccaaagctac
caagaatctaccaaacagctcactatgaagaagttaccagtagttgcctgctttcatttc
aaacgatttgaacactcagcgaaacagaggcgcaagatcacgacgtacatttccttccct
ctggagctggatatgacaccatttatggcgtcgagtaaagagacccggatgaatggacag
ttgcagctgccgaccaacagtggcaacaacgagaataagtattccttgtttgctgtggtt
aatcaccaaggaaccttggagagtggccactacaccagcttcattcggcaccacagggac
cagtggttcaagtgtgatgatgctgtaatcaccaaggccagtattaaggatgttctggac
agtgaagggtatttactgttctatcacaaacaggtcctggaacatgagccagaaaaggtg
aaagaaatgactacacaagcctactga

DBGET integrated database retrieval system