KEGG   Rattus norvegicus (rat): 302668Help
Entry
302668            CDS       T01003                                 

Gene name
Ace2
Definition
(RefSeq) angiotensin I converting enzyme 2 (EC:3.4.17.23)
  KO
K09708  
angiotensin-converting enzyme 2 [EC:3.4.17.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
Renin-angiotensin system
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    302668 (Ace2)
  Digestive system
   04974 Protein digestion and absorption
    302668 (Ace2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.23  angiotensin-converting enzyme 2
     302668 (Ace2)
Peptidases [BR:rno01002]
 Metallo Peptidases
  Family M2
   302668 (Ace2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   302668 (Ace2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
Xq21
AA seq 805 aa AA seqDB search
MSSSCWLLLSLVAVATAQSLIEEKAESFLNKFNQEAEDLSYQSSLASWNYNTNITEENAQ
KMNEAAAKWSAFYEEQSKIAQNFSLQEIQNATIKRQLKALQQSGSSALSPDKNKQLNTIL
NTMSTIYSTGKVCNSMNPQECFLLEPGLDEIMATSTDYNRRLWAWEGWRAEVGKQLRPLY
EEYVVLKNEMARANNYEDYGDYWRGDYEAEGVEGYNYNRNQLIEDVENTFKEIKPLYEQL
HAYVRTKLMEVYPSYISPTGCLPAHLLGDMWGRFWTNLYPLTTPFLQKPNIDVTDAMVNQ
SWDAERIFKEAEKFFVSVGLPQMTPGFWTNSMLTEPGDDRKVVCHPTAWDLGHGDFRIKM
CTKVTMDNFLTAHHEMGHIQYDMAYAKQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKS
IGLLPSNFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFQDKIPREQWTKKWWEM
KREIVGVVEPLPHDETYCDPASLFHVSNDYSFIRYYTRTIYQFQFQEALCQAAKHDGPLH
KCDISNSTEAGQKLLNMLSLGNSGPWTLALENVVGSRNMDVKPLLNYFQPLFVWLKEQNR
NSTVGWSTDWSPYADQSIKVRISLKSALGKNAYEWTDNEMYLFRSSVAYAMREYFSREKN
QTVPFGEADVWVSDLKPRVSFNFFVTSPKNVSDIIPRSEVEEAIRMSRGRINDIFGLNDN
SLEFLGIYPTLKPPYEPPVTIWLIIFGVVMGTVVVGIVILIVTGIKGRKKKNETKREENP
YDSMDIGKGESNAGFQNSDDAQTSF
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagctcctgctggctccttctcagccttgttgctgttgctactgctcagtccctc
atcgaggaaaaggccgagagctttttaaacaagtttaaccaggaagctgaagacctgtct
tatcaaagttcacttgcttcttggaattacaacaccaacattacggaggagaatgcccaa
aagatgaacgaggctgcggccaaatggtctgccttttatgaagaacagtccaagatcgcc
caaaatttctcactacaagaaattcagaatgcgaccatcaagcgtcaactgaaggccctt
cagcagagcgggtcttcagcgctgtcaccagacaagaacaaacagttgaacacaattcta
aacaccatgagcaccatttacagtactggaaaagtttgcaactcaatgaatccacaagaa
tgttttttacttgaaccaggattggacgaaataatggcaacaagcacagactacaatcgt
aggctctgggcttgggagggctggagggctgaggtcggcaagcagctgaggccgttatat
gaagagtatgtggtcctgaaaaatgagatggcaagagcaaacaattatgaagactatggg
gattattggcgaggggattatgaagcagagggagtagaaggttacaactacaaccgaaac
cagttgatcgaagacgtagaaaataccttcaaagagatcaaaccgttgtatgagcaactt
catgcctatgtgagaacgaagttgatggaagtgtacccttcttacatcagccctactgga
tgcctccctgctcatttgcttggtgatatgtggggtaggttttggacaaatctgtaccct
ttgactactccctttcttcagaaaccaaacatagatgttactgatgcaatggtgaatcag
agctgggatgcagaaagaatatttaaagaggcagagaagttcttcgtttctgttggcctt
cctcaaatgactccgggattctggacaaactccatgctgactgagccaggagatgaccgg
aaagttgtctgccaccccacagcttgggatctgggacatggagacttcagaatcaagatg
tgcacaaaggtcacaatggacaacttcttgacagcccatcatgagatgggacacatccaa
tatgacatggcatatgccaagcaacctttcctgctaagaaacggagccaatgaagggttc
catgaagccgttggagaaatcatgtcactttctgcagctacccccaaacatttgaaatct
attggtcttctgccatccaattttcaagaagacaatgaaacagaaataaacttcctactc
aaacaggcattgacaattgttggaacgctgccatttacttacatgttagagaagtggagg
tggatggtctttcaggataaaattcccagagaacagtggaccaaaaagtggtgggagatg
aagcgggagatcgttggtgtggtggagcctctgcctcatgatgaaacatactgtgaccct
gcatctctgttccatgtctctaatgattactcattcattcgatattacacaaggaccatt
tatcaattccagtttcaagaagctctttgtcaagcagctaaacatgatggcccactacac
aaatgtgacatctcaaattccactgaagctgggcagaagttgctcaatatgctgagtctt
ggaaactcagggccctggaccctagccttggaaaatgtggtaggatcaaggaatatggat
gtaaaaccactgctcaattacttccaaccattgtttgtctggctgaaagagcagaacagg
aattcgactgtggggtggagcactgactggagcccatatgccgaccaaagcattaaagtg
aggataagcctaaaatcagctcttgggaaaaatgcgtatgaatggaccgacaacgaaatg
tacctattccgatcatctgttgcctatgccatgagagagtatttttcaagggaaaagaac
cagacagttccttttggggaggcagacgtatgggtgagtgatttgaaaccaagagtctcc
ttcaacttctttgtcacttcacccaaaaatgtgtctgacatcattcccagaagtgaagtt
gaagaggccatcaggatgtctcggggccgtatcaatgatatttttggtctgaatgataac
agcctggagtttctggggatctacccaacacttaagccaccttacgagcctcctgtcacc
atatggctgattatttttggtgtcgtgatgggaacggtagtggttggcattgttatcctg
atcgtcactgggatcaaaggtcgaaagaagaaaaatgaaacaaaaagagaagagaatcct
tatgactccatggacattggcaaaggagaaagtaacgcaggattccaaaacagtgatgat
gctcaaacttcattctaa

DBGET integrated database retrieval system