KEGG   Rattus norvegicus (rat): 303179Help
Entry
303179            CDS       T01003                                 

Gene name
Guk1
Definition
guanylate kinase 1 (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
rno  Rattus norvegicus (rat)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    303179 (Guk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     303179 (Guk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q22
AA seq 219 aa AA seqDB search
MLRRPLVGLAVAALGRVPVDGMAGPRPVVLSGPSGAGKSTLLKKLFQEHGSVFGFSVSHT
TRNPRPGEEDGKDYYFVTREMMQRDIAAGDFIEHAEFSGNLYGTSKEAVRAVQAMNRICV
LDVDLQGVRSIKKTDLHPIYISVQPPSMDVLEQRLRQRNTETEESLAKRLAAAQADMESS
KEPGLFDLVIVNDNLDEAYVTLKQALSEEIKKAEGTEHA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggcgcccgctggtcgggctggcggtggccgccctgggtcgcgttcccgtggac
ggcatggcaggacctaggccagtagtgctgagcgggccatcaggggcagggaagagcact
ctgctcaagaagttgttccaggaacatggcagtgtctttggcttcagcgtatcccacact
acaaggaacccacgacctggcgaagaagatggcaaagattactactttgtgaccagggag
atgatgcagcgtgatattgcagcaggggacttcattgagcatgctgagttctcagggaac
ctgtatgggacaagcaaggaagccgtccgggctgtgcaggccatgaaccgcatctgcgtg
ctagatgtcgacctacaaggagtgcgcagcatcaagaagactgatctgcatcccatctac
atctctgtgcagcctccctcgatggacgtgctggagcaacgactgcggcagcgcaacact
gagactgaggagagcctggcaaagcggctggcagctgcacaggcagacatggagagcagc
aaggagcctggcttgtttgacctggtgatcgtcaatgacaacctggatgaagcctatgtt
acactgaagcaggcactgtctgaggaaatcaagaaagctgagggaactgaacatgcctga

DBGET integrated database retrieval system