KEGG   Rattus norvegicus (rat): 303200Help
Entry
303200            CDS       T01003                                 

Gene name
Map2k3, Mek3, Mkk3
Definition
(RefSeq) mitogen activated protein kinase kinase 3
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04015  Rap1 signaling pathway
rno04218  Cellular senescence
rno04620  Toll-like receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04668  TNF signaling pathway
rno04714  Thermogenesis
rno04750  Inflammatory mediator regulation of TRP channels
rno04912  GnRH signaling pathway
rno05014  Amyotrophic lateral sclerosis (ALS)
rno05145  Toxoplasmosis
rno05164  Influenza A
rno05169  Epstein-Barr virus infection
Module
rno_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    303200 (Map2k3)
   04010 MAPK signaling pathway
    303200 (Map2k3)
   04668 TNF signaling pathway
    303200 (Map2k3)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    303200 (Map2k3)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    303200 (Map2k3)
   04664 Fc epsilon RI signaling pathway
    303200 (Map2k3)
  Endocrine system
   04912 GnRH signaling pathway
    303200 (Map2k3)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    303200 (Map2k3)
  Environmental adaptation
   04714 Thermogenesis
    303200 (Map2k3)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    303200 (Map2k3)
  Infectious diseases
   05164 Influenza A
    303200 (Map2k3)
   05169 Epstein-Barr virus infection
    303200 (Map2k3)
   05145 Toxoplasmosis
    303200 (Map2k3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     303200 (Map2k3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE7 family
   303200 (Map2k3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 APH Choline_kinase RIO1 DUF4344
Motif
Other DBs
NCBI-GeneID: 303200
NCBI-ProteinID: NP_001094144
RGD: 1306620
Ensembl: ENSRNOG00000049132
UniProt: B1H230 Q498S1
Position
10q22
AA seq 347 aa AA seqDB search
MESPAASPPASLPQTKGKSKRKRDLRISCVSKPPVSNPTPPRNLDSRTFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLEKNMKIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADQFSPEFVD
FTSQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgcccgccgccagcccgccggccagcttgcctcagaccaaaggaaaatccaaa
aggaaaagggatttacggatatcctgtgtgtccaagccacccgtgtccaaccccacaccc
ccccggaacctggactcccggaccttcatcactatcggagacagaaacttcgaagtggag
gctgatgacttggtgaccatctcagagctgggccgcggagcctatggggtggtggagaag
gtgcggcatgctcagagtggtaccatcatggctgtcaagcgcatccgggccactgtgaac
tcacaggagcagaaacgtctgcttatggacctagacatcaacatgcgcactgtcgactgc
ttctatactgtcaccttctatggtgccctctttagagagggggatgtgtggatctgcatg
gaactcatggacacgtccctggataagttctaccggaaggtgctagagaagaacatgaaa
attccggaagacattctgggggagattgctgtatccatcgtgcgggccctggagcaccta
cacagcaagctgtctgtgatccacagagatgtgaagccttccaatgtcctcatcaacaaa
gaggggcacgtgaagatgtgcgactttggcatcagtggctacctggtggactctgtggca
aagacaatggatgctggctgcaagccttacatggcccctgagaggatcaaccctgagctg
aatcagaagggctacaacgtcaagtctgatgtctggagccttggcatcaccatgattgag
atggccattctgcgattcccttacgagtcttgggggacaccgttccagcagctgaagcag
gtggtggaggagccatccccacagctcccagcagaccagttctcccctgagtttgtggac
ttcacaagccagtgcctcaggaagaatcctgcggaacgcatgagctacctggagctgatg
gaacacccgttcttcaccttgcacaaaactaagaagacggacattgctgcctttgtgaag
gagatcctgggagaggattcatag

DBGET integrated database retrieval system