KEGG   Rattus norvegicus (rat): 303201Help
Entry
303201            CDS       T01003                                 

Gene name
Usp22
Definition
(RefSeq) ubiquitin specific peptidase 22
  KO
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     303201 (Usp22)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   303201 (Usp22)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     303201 (Usp22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q22
AA seq 525 aa AA seqDB search
MVARPEPEVEAMDAELAVAPPGCSHLGSFKVDNWKQNLRAIYQCFVWSGTAEARKRKAKS
CVCHVCGIHLNRLHSCLYCVFFGCFTKKHIHDHAKSKRHNLAIDLMYGGIYCFLCQDYIY
DKDIEIIAKEEQRKAWKMQGVGEKFSTWEPTKRELELLKHNPKRRKITSNCTIGLRGLIN
LGNTCFMNCIVQALTHTPLLRDFFLSDRHRCEMQSPSSCLVCEMSSLFQEFYSGHRSPHI
PYKLLHLVWTHARHLAGYEQQDAHEFLIAALDVLHRHCKGDDNGKKANNPNHCNCIIDQI
FTGGLQSDVTCQVCHGVSTTIDPFWDISLDLPGSSTPFWPLSPGSEGSVVNGESHASGTT
TLTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRR
KITTYVSFPLELDMTPFMASSKESRMNGQYQQPLDSLNNDNKYSLFAVVNHQGTLESGHY
TSFIRQHKDQWFKCDDAIITKASIKDVLDSEGYLLFYHKQFLEYE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggtggccaggcccgagcctgaggtcgaggccatggacgctgagctggcggtggcgccg
ccaggctgctcgcacctgggcagcttcaaggtggacaactggaagcaaaacctgcgggcc
atctaccagtgcttcgtatggagcggaactgccgaggctcgcaagcgcaaggcaaagtcc
tgtgtctgccatgtctgcggcattcacctgaaccggctgcactcttgcctctactgtgtc
ttctttggctgtttcacgaagaagcacatccatgaccatgctaagtcaaagcggcacaac
ctggccattgacctgatgtatggaggtatttactgcttcttgtgccaggactacatctat
gacaaagacatagaaatcattgccaaagaggagcagcgcaaggcttggaagatgcaaggt
gttggagagaagttttcgacttgggaaccaactaaacgagagctggagctgctgaagcac
aacccgaagaggcggaagatcacctccaactgcaccataggtctgcgtggactgatcaac
ctggggaacacatgtttcatgaactgcatcgtgcaggcgctaacccacacgccgcttctg
agggacttctttctgtcagataggcaccgctgtgagatgcagagccccagctcctgcctg
gtctgcgagatgtcctctctcttccaggagttttactcggggcaccgctccccacacatt
ccgtacaagctgctgcacctggtgtggacgcacgcccggcacctggcaggttatgagcag
caggacgcccatgagttcctcattgcagccctggacgtcctccaccggcactgcaaaggt
gatgacaacgggaagaaagccaacaaccctaaccactgcaattgcatcattgaccagatc
ttcacgggtgggctccagtctgatgtcacatgccaggtctgccatggggtctccaccacc
atagaccccttctgggacatcagtttagacctgcccggttcttccaccccattctggccc
ttaagcccagggagcgagggcagtgtcgtcaatggggagagccacgcgtctgggaccacc
actctcacagactgcctgcgaagatttaccagaccagaacacttaggaagcagtgccaag
atcaagtgtagtggttgccatagctaccaagagtccacaaagcagctcaccatgaagaag
ctacccattgtggcctgcttccatctcaaacgatttgaacactcagccaaacttcggcgg
aagatcaccacatatgtgtcttttcccctggaattggacatgacgccctttatggcctcc
agcaaagagagcaggatgaatgggcagtaccagcagcccctggacagtctcaacaatgac
aacaaatactccttgtttgctgtcgttaaccaccaagggaccttggagagtggccactac
accagcttcatccggcagcacaaagaccagtggttcaagtgtgatgacgccatcatcacc
aaggccagcatcaaagatgtgctggacagcgaagggtacctgctcttctaccacaaacag
ttcctggaatatgagtag

DBGET integrated database retrieval system