KEGG   Rattus norvegicus (rat): 303201Help
Entry
303201            CDS       T01003                                 

Gene name
Usp22
Definition
ubiquitin specific peptidase 22
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q22
AA seq 525 aa AA seqDB search
MVARPEPEVEAMDAELAVAPPGCSHLGSFKVDNWKQNLRAIYQCFVWSGTAEARKRKAKS
CVCHVCGIHLNRLHSCLYCVFFGCFTKKHIHDHAKSKRHNLAIDLMYGGIYCFLCQDYIY
DKDIEIIAKEEQRKAWKMQGVGEKFSTWEPTKRELELLKHNPKRRKITSNCTIGLRGLIN
LGNTCFMNCIVQALTHTPLLRDFFLSDRHRCEMQSPSSCLVCEMSSLFQEFYSGHRSPHI
PYKLLHLVWTHARHLAGYEQQDAHEFLIAALDVLHRHCKGDDNGKKANNPNHCNCIIDQI
FTGGLQSDVTCQVCHGVSTTIDPFWDISLDLPGSSTPFWPLSPGSEGSVVNGESHASGTT
TLTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRR
KITTYVSFPLELDMTPFMASSKESRMNGQYQQPLDSLNNDNKYSLFAVVNHQGTLESGHY
TSFIRQHKDQWFKCDDAIITKASIKDVLDSEGYLLFYHKQFLEYE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggtggccaggcccgagcctgaggtcgaggccatggacgctgagctggcggtggcgccg
ccaggctgctcgcacctgggcagcttcaaggtggacaactggaagcaaaacctgcgggcc
atctaccagtgcttcgtatggagcggaactgccgaggctcgcaagcgcaaggcaaagtcc
tgtgtctgccatgtctgcggcattcacctgaaccggctgcactcttgcctctactgtgtc
ttctttggctgtttcacgaagaagcacatccatgaccatgctaagtcaaagcggcacaac
ctggccattgacctgatgtatggaggtatttactgcttcttgtgccaggactacatctat
gacaaagacatagaaatcattgccaaagaggagcagcgcaaggcttggaagatgcaaggt
gttggagagaagttttcgacttgggaaccaactaaacgagagctggagctgctgaagcac
aacccgaagaggcggaagatcacctccaactgcaccataggtctgcgtggactgatcaac
ctggggaacacatgtttcatgaactgcatcgtgcaggcgctaacccacacgccgcttctg
agggacttctttctgtcagataggcaccgctgtgagatgcagagccccagctcctgcctg
gtctgcgagatgtcctctctcttccaggagttttactcggggcaccgctccccacacatt
ccgtacaagctgctgcacctggtgtggacgcacgcccggcacctggcaggttatgagcag
caggacgcccatgagttcctcattgcagccctggacgtcctccaccggcactgcaaaggt
gatgacaacgggaagaaagccaacaaccctaaccactgcaattgcatcattgaccagatc
ttcacgggtgggctccagtctgatgtcacatgccaggtctgccatggggtctccaccacc
atagaccccttctgggacatcagtttagacctgcccggttcttccaccccattctggccc
ttaagcccagggagcgagggcagtgtcgtcaatggggagagccacgcgtctgggaccacc
actctcacagactgcctgcgaagatttaccagaccagaacacttaggaagcagtgccaag
atcaagtgtagtggttgccatagctaccaagagtccacaaagcagctcaccatgaagaag
ctacccattgtggcctgcttccatctcaaacgatttgaacactcagccaaacttcggcgg
aagatcaccacatatgtgtcttttcccctggaattggacatgacgccctttatggcctcc
agcaaagagagcaggatgaatgggcagtaccagcagcccctggacagtctcaacaatgac
aacaaatactccttgtttgctgtcgttaaccaccaagggaccttggagagtggccactac
accagcttcatccggcagcacaaagaccagtggttcaagtgtgatgacgccatcatcacc
aaggccagcatcaaagatgtgctggacagcgaagggtacctgctcttctaccacaaacag
ttcctggaatatgagtag

DBGET integrated database retrieval system