KEGG   Rattus norvegicus (rat): 303252Help
Entry
303252            CDS       T01003                                 

Gene name
Alox12e, 12-LOX
Definition
arachidonate 12-lipoxygenase, epidermal (EC:1.13.11.31)
Orthology
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
rno  Rattus norvegicus (rat)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    303252 (Alox12e)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    303252 (Alox12e)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    303252 (Alox12e)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     303252 (Alox12e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q24
AA seq 662 aa AA seqDB search
MGKYKILVVTGDSLLAGSTNLVQLWLVGEHAEADLGKQLRPLRGRKTELEIDVPLHLGRL
LVVKLRKHKGLLDSDWFCKWITVQGPGIQGEAFFPCYSWVQGKETIYLPEGTALKVNDDT
KNLFRKYREQELEDRRNVYRWGSWKEGLILPIAGSTERDLPRNQRFMEDKDLDFSLSLAK
VLKDFAIKGTLDFVSRVQHLEDYQKVFPHSKTALAGRVRDSWKEDALFGYQFLNGANPML
LRRSKRLPARLVLPPGMEDLQTQLEKELKAGSLFEADFSLLDGVKPNVIIFKQQHVAAPL
VMLKLQSDGRLLPMVIQLQPPRHGCPPPLLFLPSDPPMAWLLAKIWVRSSDFQVHQLQSH
LLRGHLMAEVISVATMRSLPSLHPIYKLLAPHFRYTMEINTLARNNLVSEWGIFDLVVST
GSGGHVDILQRATACLTYRSFCPPDDLADRGLLDVKSSLYARDALRLWEIISRYVGRMVE
LFYKNDREVKEDPELQVWCREVTEIGLLGAQDRGFPLSLESRAQLCRFVTMCIFTCTGQH
ASTHLGQLDWYSWIPNGPCTMRKPPPTSKNVTEGDILDALPCLQQARMQITFTKFLGRHQ
PVMVALGQHKEEYFSDPGARAVLKQFQEELAVMDKEIEVRNASLDLPYEYLRPSMVENSV
TI
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagtacaagatccttgtggtcactggagattcgcttttggcgggctccaccaac
ctggtgcagctgtggctggtgggcgagcatgcggaggcagaccttgggaagcagctgcgg
ccactgcggggaaggaagacagagctggagatcgacgtccccttgcatctagggcgcctc
ctggtggtaaagcttcgcaaacacaaaggcctattggattctgactggttctgcaagtgg
atcactgtgcagggccctgggatccaaggagaagcctttttcccctgctacagttgggtg
cagggcaaggagactatctacctacccgagggcactgccctgaaggtaaacgacgacact
aagaacctgtttaggaagtatcgagagcaggagctggaggacagaaggaatgtgtatcgg
tggggctcctggaaggagggattaatcctgcctatagcaggaagtacagagcgggacctc
cccaggaaccagagattcatggaggataaggatttagatttttccctctctctggccaaa
gtgttgaaggactttgctattaaggggactctagacttcgtaagtcgtgtacaacatctg
gaagattaccagaaagtatttccacatagcaagactgctctggccggacgggtccgtgac
tcctggaaggaagatgccctctttgggtaccagttcctcaacggtgcaaaccccatgctc
ctgaggcggtctaagcgccttccagcccggctggtcctgcctccagggatggaagattta
caaacccagctggagaaggagctcaaggctggatctctgtttgaagccgatttctccctg
ctggatggggtgaagcctaatgtcataatttttaagcagcaacacgtggcagcccctttg
gtcatgctgaagctacagtctgatgggagactcttacccatggtcattcagctccagcca
cctcgacatgggtgtcccccacccctgctcttcctgccctcggaccctcccatggcctgg
cttctggccaagatctgggtccgaagctctgatttccaagtgcaccagttacagtcacat
ctgctaaggggacatctaatggccgaggttatctctgtggccacaatgaggagcttaccc
agcctgcatcccatatacaagctccttgccccccactttcgctacaccatggagatcaac
accctggcacggaataatcttgtctcggaatggggaatttttgatctggtggtgagcaca
gggagtggaggccacgtggacattctccagagagccacagcgtgtttgacctaccgctcc
ttttgccctccggatgacttggctgaccgtgggctcttggacgtgaaatcttctctttat
gcccgggatgccctcagattatgggagatcatcagtcggtatgtgggaaggatggttgag
cttttctacaagaatgacagagaggtgaaggaagatccggagctgcaggtctggtgccga
gaggtcactgagatcggactgcttggggcccaggaccgagggttccccctgtccttagag
tcccgggctcagctgtgtcgtttcgtcaccatgtgcatcttcacgtgcactggtcagcat
gcatctacacatctgggtcagctggactggtattcctggatcccaaatggcccatgcacc
atgcggaagcccccacccacctccaagaatgtgacagagggggacattttggacgcattg
ccttgtctccagcaggcacggatgcagattacattcaccaagttcctcggcagacaccag
cctgtcatggtggccctggggcagcataaagaggaatatttctcagaccccggggcccgg
gctgtgctgaagcagttccaggaggagctggctgtcatggacaaggagattgaggtccgg
aatgcaagcctggacctgccctatgagtacctccgacccagcatggtggagaacagtgtg
accatctga

DBGET integrated database retrieval system