KEGG   Rattus norvegicus (rat): 303252Help
Entry
303252            CDS       T01003                                 

Gene name
Alox12e, 12-LOX
Definition
(RefSeq) arachidonate 12-lipoxygenase, epidermal (EC:1.13.11.31)
  KO
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
rno  Rattus norvegicus (rat)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Antifolate resistance
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    303252 (Alox12e)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    303252 (Alox12e)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    303252 (Alox12e)
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    303252 (Alox12e)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     303252 (Alox12e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q24
AA seq 662 aa AA seqDB search
MGKYKILVVTGDSLLAGSTNLVQLWLVGEHAEADLGKQLRPLRGRKTELEIDVPLHLGRL
LVVKLRKHKGLLDSDWFCKWITVQGPGIQGEAFFPCYSWVQGKETIYLPEGTALKVNDDT
KNLFRKYREQELEDRRNVYRWGSWKEGLILPIAGSTERDLPRNQRFMEDKDLDFSLSLAK
VLKDFAIKGTLDFVSRVQHLEDYQKVFPHSKTALAGRVRDSWKEDALFGYQFLNGANPML
LRRSKRLPARLVLPPGMEDLQTQLEKELKAGSLFEADFSLLDGVKPNVIIFKQQHVAAPL
VMLKLQSDGRLLPMVIQLQPPRHGCPPPLLFLPSDPPMAWLLAKIWVRSSDFQVHQLQSH
LLRGHLMAEVISVATMRSLPSLHPIYKLLAPHFRYTMEINTLARNNLVSEWGIFDLVVST
GSGGHVDILQRATACLTYRSFCPPDDLADRGLLDVKSSLYARDALRLWEIISRYVGRMVE
LFYKNDREVKEDPELQVWCREVTEIGLLGAQDRGFPLSLESRAQLCRFVTMCIFTCTGQH
ASTHLGQLDWYSWIPNGPCTMRKPPPTSKNVTEGDILDALPCLQQARMQITFTKFLGRHQ
PVMVALGQHKEEYFSDPGARAVLKQFQEELAVMDKEIEVRNASLDLPYEYLRPSMVENSV
TI
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagtacaagatccttgtggtcactggagattcgcttttggcgggctccaccaac
ctggtgcagctgtggctggtgggcgagcatgcggaggcagaccttgggaagcagctgcgg
ccactgcggggaaggaagacagagctggagatcgacgtccccttgcatctagggcgcctc
ctggtggtaaagcttcgcaaacacaaaggcctattggattctgactggttctgcaagtgg
atcactgtgcagggccctgggatccaaggagaagcctttttcccctgctacagttgggtg
cagggcaaggagactatctacctacccgagggcactgccctgaaggtaaacgacgacact
aagaacctgtttaggaagtatcgagagcaggagctggaggacagaaggaatgtgtatcgg
tggggctcctggaaggagggattaatcctgcctatagcaggaagtacagagcgggacctc
cccaggaaccagagattcatggaggataaggatttagatttttccctctctctggccaaa
gtgttgaaggactttgctattaaggggactctagacttcgtaagtcgtgtacaacatctg
gaagattaccagaaagtatttccacatagcaagactgctctggccggacgggtccgtgac
tcctggaaggaagatgccctctttgggtaccagttcctcaacggtgcaaaccccatgctc
ctgaggcggtctaagcgccttccagcccggctggtcctgcctccagggatggaagattta
caaacccagctggagaaggagctcaaggctggatctctgtttgaagccgatttctccctg
ctggatggggtgaagcctaatgtcataatttttaagcagcaacacgtggcagcccctttg
gtcatgctgaagctacagtctgatgggagactcttacccatggtcattcagctccagcca
cctcgacatgggtgtcccccacccctgctcttcctgccctcggaccctcccatggcctgg
cttctggccaagatctgggtccgaagctctgatttccaagtgcaccagttacagtcacat
ctgctaaggggacatctaatggccgaggttatctctgtggccacaatgaggagcttaccc
agcctgcatcccatatacaagctccttgccccccactttcgctacaccatggagatcaac
accctggcacggaataatcttgtctcggaatggggaatttttgatctggtggtgagcaca
gggagtggaggccacgtggacattctccagagagccacagcgtgtttgacctaccgctcc
ttttgccctccggatgacttggctgaccgtgggctcttggacgtgaaatcttctctttat
gcccgggatgccctcagattatgggagatcatcagtcggtatgtgggaaggatggttgag
cttttctacaagaatgacagagaggtgaaggaagatccggagctgcaggtctggtgccga
gaggtcactgagatcggactgcttggggcccaggaccgagggttccccctgtccttagag
tcccgggctcagctgtgtcgtttcgtcaccatgtgcatcttcacgtgcactggtcagcat
gcatctacacatctgggtcagctggactggtattcctggatcccaaatggcccatgcacc
atgcggaagcccccacccacctccaagaatgtgacagagggggacattttggacgcattg
ccttgtctccagcaggcacggatgcagattacattcaccaagttcctcggcagacaccag
cctgtcatggtggccctggggcagcataaagaggaatatttctcagaccccggggcccgg
gctgtgctgaagcagttccaggaggagctggctgtcatggacaaggagattgaggtccgg
aatgcaagcctggacctgccctatgagtacctccgacccagcatggtggagaacagtgtg
accatctga

DBGET integrated database retrieval system