KEGG   Rattus norvegicus (rat): 303470Help
Entry
303470            CDS       T01003                                 

Gene name
Kat7, Myst2
Definition
K (lysine) acetyltransferase 7 (EC:2.3.1.48)
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     303470 (Kat7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q31
AA seq 612 aa AA seqDB search
MAIGVKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPV
RNLPSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQAVDFSDRETKNTA
DHDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESY
NFNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDKQIEERMLSHR
QDDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRQTYGNTREPLLE
NLTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEY
ARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQ
NLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMP
QYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEI
SIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMD
PSCLKWTPPKGT
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggcgataggtgtaaagagaaatgcaggcagtagttcagatggaaccgaagattccgat
ttttctacagatctcgagcatacagacagttcagagagtgacggcacatcgcgccgatct
gcccgagtcacccgctcttcagccaggctaagccagagttctcaagattccagccctgtt
cgaaatttgccatctttcggcactgaggaacccgcctattctaccagaagagtgactcgg
agtcagcagcagcccacaccagtgactccaaaaaagtaccccctccggcagactcgctcc
tcgggctctgaaacggaacaggcggttgatttttcagatagagaaactaaaaatacagct
gatcatgatgagtcgccacctcgaactccgactggaaatgcaccttcttctgagtctgac
atagacatctccagtcccaatgtgtctcatgatgagagcattgccaaggacatgtccctg
aaggactcaggcagtgatctctctcaccgccccaagcgtcgtcgatttcacgaaagctac
aatttcaacatgaagtgccctacgccgggctgcaactctctaggacatcttacaggaaag
cacgagagacatttctccatctcaggatgcccgctgtatcataacctctcggctgacgag
tgcaaggtgagagcacagagccgggataagcagatagaagagaggatgctgtcccacagg
caagatgacaacaacaggcatgcaaccaggcaccaggcaccaacagagagacagctgcgg
tataaggaaaaagtggctgaactcaggaagaaaagaaattctggactgagcaaagagcag
aaagagaaatacatggaacacagacagacctatgggaacactcgggagcctctcttggaa
aacctgacgagtgaatatgacttagatcttttccgaagagcacaagcccgggcttctgag
gatttggagaagttaaggcttcaaggccaaatcacagagggaagcaacatgattaaaaca
attgcttttggccgctacgagctggatacttggtaccattctccctatcctgaagaatat
gcacgactgggacgtctctacatgtgtgaattctgcttaaaatacatgaagagccaaacg
attctccgccgacacatggccaagtgtgtgtggaaacacccccctggtgatgagatttat
cgcaaaggctccatctctgtgtttgaagtagatggcaagaaaaacaagatctactgccaa
aacctctgccttttggcgaagctttttctggaccataagaccttatactacgatgtagag
cccttcctgttctacgttatgacagaagcagacaatactggctgccacctgattggatat
ttttctaaggagaagaattcatttctcaactacaatgtctcctgtattctcaccatgcct
cagtacatgagacagggctatgggaagatgctcattgacttcagttatttactttccaag
gtagaagagaaagttggctctccggaacgcccactgtcagacctggggcttataagctac
cgcagctactggaaggaagtactgctccggtacctgcacaacttccagggcaaggagatc
tccatcaaagaaattagccaggaaacagctgtgaatcccgtggacattgtcagcactctg
caagcccttcagatgctcaagtattggaaagggaagcacctagttttaaagagacaggac
ctgatagatgaatggatcgccaaagaggccaaaaggtccaactccaacaaaaccatggat
ccaagctgcttaaaatggacccctcccaagggcacttaa

DBGET integrated database retrieval system