KEGG   Rattus norvegicus (rat): 304775Help
Entry
304775            CDS       T01003                                 

Gene name
Dyrk3
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3 (EC:2.7.12.1)
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     304775 (Dyrk3)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   304775 (Dyrk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
13q13
AA seq 586 aa AA seqDB search
MGGAARERGRKDAALPGAGLPPQQRRLGDGVYDTFMMIDETKCPPYTNTLCNPSEAPVSR
RLNITTEPFTRGHTQHFVSGGVMKVEQLFQEFGSRRTSTLQSDGVSNSEKSSPASQGKSS
DSLGTVKCSLSSRPSKVLPLTPEQALKQYKHHLTAYEKLEIISYPEIYFVGPNAKKRQGV
IGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVR
NEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKK
NKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSATKVIDFGSSCF
EYQKLYTYIQSRFYRAPEIILGCRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACM
MELLGMPPQKLLEQSKRAKYFINSKGLPRYCSVTTQTDGRVVLLGGRSRRGKKRGPPGSK
DWAAALKGCDDYLFIEFLKRCLQWDPSARLTPAQALRHPWISKSAPRPLTTDKVSGKRVV
NPTNAFQGLGSKLPPVVGIASKLKANLMSETSGSIPLCSVLPKLIS
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgggaggcgcagcccgcgagcgcgggaggaaggacgcggcgctgccgggggccgggctc
ccgccgcagcagcggaggttgggggatggtgtctatgataccttcatgatgatagatgaa
accaagtgcccaccctatacaaacacactttgcaatccctctgaagcacctgtctccaga
aggctaaatattaccactgagccattcacgagaggccacactcagcacttcgtgagtggg
ggtgtgatgaaggtggagcaactgtttcaagaatttggcagcagaagaaccagtactctc
cagtccgatggcgtcagcaactccgaaaagtcctctcctgcttctcaggggaagagttca
gacagcctgggtacagtgaagtgcagcctctcatccagaccatctaaggtgctcccgctg
actcctgagcaagctctgaagcagtacaagcaccacctcaccgcctacgagaagctggag
atcatcagctacccagaaatctacttcgtgggcccgaatgccaagaagcggcaaggagtt
attggtggtcccaataacggggggtacgacgatgcggacggggcctatatccacgtgcct
cgagaccatctggcttaccgctatgaggtgctgaaaattattggcaaggggagttttgga
caggtagcccgggtctacgatcacaaactccgacagtacgtggccctgaaaatggtgcgc
aacgagaagcgctttcaccgccaggcagccgaggagatccggattctggagcatcttaaa
aagcaagacaaaactgggagcatgaatgtcatccacatgttagaaagcttcaccttccgg
aaccacgtgtgcatggcctttgagttgctaagcatagacctgtacgagctcattaaaaaa
aacaagtttcagggcttcagcgtccagttggtccggaagttcgcccagtccatcctgcag
tccttggacgcccttcacaaaaataagatcattcactgtgatctgaagcctgagaacatt
ctcctgaagcatcacggacggagcgcgaccaaggtcattgacttcgggtccagctgtttt
gagtatcagaaactttacacgtacatccagtcccgtttctacagagccccggaaatcatc
ttggggtgccgctacagcacgccaattgacatatggagttttggttgcatcctcgcagaa
cttttgacaggacagcccctgttcccaggagaggatgaaggagaccagttggcctgcatg
atggagttgctaggaatgccaccacagaaacttctggagcaatccaaacgtgccaagtac
tttattaactccaaaggcttgcctcgatactgctccgtaactacccagacggacgggagg
gttgtgcttctcgggggccgctcacgcaggggtaaaaagcgaggcccaccaggcagcaaa
gactgggcagccgcgctgaaggggtgcgatgactacttgttcatagagtttctgaaaagg
tgccttcagtgggacccctctgcccgcctcaccccagctcaagcattaagacatccttgg
attagcaagtctgcacccaggcccctcaccacggacaaggtgtcagggaaacgggtagtt
aatcctacaaatgctttccagggactgggctccaagctgcctccagtcgttggaatcgcc
agtaagcttaaagctaacctaatgtcggaaaccagtggtagtatacctctgtgcagtgta
ttgccaaagctgatcagctaa

DBGET integrated database retrieval system