KEGG   Rattus norvegicus (rat): 305264Help
Entry
305264            CDS       T01003                                 

Gene name
Ugt2b10, Ugt2b34
Definition
UDP glucuronosyltransferase 2 family, polypeptide B10 (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    305264 (Ugt2b10)
   00053 Ascorbate and aldarate metabolism
    305264 (Ugt2b10)
   00500 Starch and sucrose metabolism
    305264 (Ugt2b10)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    305264 (Ugt2b10)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    305264 (Ugt2b10)
   00860 Porphyrin and chlorophyll metabolism
    305264 (Ugt2b10)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    305264 (Ugt2b10)
   00982 Drug metabolism - cytochrome P450
    305264 (Ugt2b10)
   00983 Drug metabolism - other enzymes
    305264 (Ugt2b10)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    305264 (Ugt2b10)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     305264 (Ugt2b10)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   305264 (Ugt2b10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
14p21
AA seq 532 aa AA seqDB search
MSVKRTASLLLLLLQLSDFFGSGTGGKVLVWPMEFSHWLNLRVILDELLKKGHEVTVLRP
SASLSYEVDNTSAIEFETYPTSYSLTEVDEFFWESLRKYIYELPKQSFWGYFLMFQELVW
VDSDYFESLCKDVVFNKELMTKLQNSGFDVILADPFIPCGDLLAEILKIPLVYSLRFFPG
STYEKYSGGLPMPPSYVPIAMSELSDRMTFVERMKHMIYVLCFDFWFQAFNEKKWNELYT
EVLGRPTTLSETMAKADIWLIRTYWDLEFPHPVLPNFDFVGGLHCRPAKPLPKEIEDFVQ
SSGEHGVVVFSLGSMVGNLTEERANVIAAGLAQIPQKVLWRFEGKKPETLGSNTRLYKWI
PQNDLLGHPKTRAFITHGGTNGIYEAIYHGIPVVGIPLFGDQYDNIVHLKTKGAAVRLDF
LTMSSTDLFTALKTITNDPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLR
VAAHDLSWVQYHSLDVIGFLLACVVTVMFILKKCCLFCCQKFTKAGRKKKRE
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgaaaaggacagcatccctgctcctgctcctgctccagctgagtgacttcttt
ggatctggaactggtgggaaggtgctagtgtggccaatggagttcagccattggctcaac
ttaagggtgatcctagatgaacttctgaagaagggtcatgaagtgacggttctgagacct
tcggcgtccttatcttatgaggttgacaacacatctgctattgaattcgagacttatcct
acatcatactcattaactgaggtagacgaatttttctgggaatcactcagaaaatatatt
tatgagctgccaaagcagtcattttggggatactttttaatgtttcaagaattggtttgg
gtagattcagattattttgagagtctctgtaaagatgtagtctttaacaaagaactcatg
acgaagctacaaaactctggctttgatgtcatcctggcagatcccttcataccctgtggt
gacctgctggccgagattctcaagatacccttagtgtacagtctccgcttctttcctggc
tccacttatgaaaagtacagtggaggactcccaatgcctccttcctatgtgcccattgct
atgtcagaattaagcgacagaatgacattcgtggagaggatgaaacacatgatctatgta
ctttgttttgacttttggttccaagcatttaatgagaagaagtggaacgagctttacact
gaagtattaggaagacccactacactctcagagactatggcaaaggcagacatatggctc
attaggacctactgggatttggaattccctcaccctgtcttaccaaattttgattttgtt
ggtggactccactgcagacctgccaaacccctgcctaaggaaatagaagacttcgtccag
tcatctggagaacatggtgttgtggtgttttccctggggtcgatggtgggaaacctaaca
gaagaaagggccaatgtgattgcagcaggccttgcccagattccacagaaggttctttgg
agatttgaaggcaagaagccagaaaccttgggctccaacactcgtctgtacaaatggatc
ccccagaatgaccttctaggtcatcccaaaaccagagcttttataactcatggtggcacc
aatggcatctatgaggcaatctaccacgggattcctgtggttggcattcctttgtttgga
gatcaatatgacaatattgttcacttgaagacaaaaggagcagcagttagactggacttt
ctcaccatgtccagtacagacttgttcactgcactgaagacaatcactaatgacccttcc
tataaggagaatgccatgagattatcaagaatccaccacgatcagccagtgaaacctctg
gatagagccgtcttctggattgagtttgtcatgcgtcacaaaggagccaagcaccttcgt
gtggcagcgcatgacctcagctgggtccaataccactctctggatgtcattgggttcctg
ctggcctgtgtggtgactgtgatgttcatcctcaaaaagtgttgcctcttttgttgtcag
aagtttacaaaagctggaagaaagaagaaaagggaatag

DBGET integrated database retrieval system