KEGG   Rattus norvegicus (rat): 305291Help
Entry
305291            CDS       T01003                                 

Gene name
Srd5a3, RGD1308828, S5AR_3
Definition
steroid 5 alpha-reductase 3 (EC:1.3.1.22 1.3.1.94)
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
rno  Rattus norvegicus (rat)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    305291 (Srd5a3)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     305291 (Srd5a3)
    1.3.1.94  polyprenol reductase
     305291 (Srd5a3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
14p11
AA seq 278 aa AA seqDB search
MAGWAGAELSVLNPLRALWLLLAAAFLLALLLQLAPARLLPSCALFQDLIRYGKTKQSGS
RRPAVCRAFDVPKRYFSHFYVVSVLWNGSLLWFLSQSLFLGAPFPSWLWALLRTLGVTQF
QALGMESKASRIQAGELALSTFLVLVFLWVHSLRRLFECFYVSVFSNTAIHVVQYCFGLV
YYVLVGLTVLSQVPMNDKNVYALGKNLLLQARWFHILGMMMFFWSSAHQYKCHVILSNLR
RNKKGVVIHCQHRIPFGDWFELYGEERSPGDRFPSSRR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggctggttgggcgggggccgagctctcggtcctgaacccgctgcgtgcgctgtggctg
ttgctggccgccgccttcctgctcgcactgctgctgcagctggcgcccgccaggctgcta
ccgagctgcgcgctcttccaggacctcatccgctacgggaagaccaagcagtccggctcg
cggcgccccgccgtctgcagggccttcgacgtccccaagaggtacttttctcacttctac
gtcgtctcagtgttatggaatggctccctgctctggttcctgtctcagtctctgttcctg
ggagcgccgtttccaagctggctttgggctttgctcagaactcttggggtcacgcagttc
caagccctggggatggagtccaaggcttctcggatacaagcaggcgagctggctctgtct
accttcttagtgttggtgttcctctgggtccatagtcttcggagactcttcgagtgcttc
tacgtcagcgtcttctctaacacggccattcacgtcgtgcagtactgtttcgggctggtc
tactatgtccttgttggcctgaccgtactgagccaagtgcccatgaatgacaagaacgtg
tacgctctggggaagaatctactgctacaagctcggtggttccacatcttgggaatgatg
atgttcttctggtcctctgcccatcagtataagtgccacgtcattctcagcaatctcagg
agaaataagaaaggtgtggtcatccactgccagcacagaatcccctttggagactggttc
gagctttatggtgaagagcgcagcccaggtgacaggttcccttcctcgagacgctga

DBGET integrated database retrieval system