KEGG   Rattus norvegicus (rat): 305450Help
Entry
305450            CDS       T01003                                 

Gene name
Sh3bp2
Definition
(RefSeq) SH3-domain binding protein 2
  KO
K07984  
SH3-domain binding protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    305450 (Sh3bp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
14q21
AA seq 591 aa AA seqDB search
MGFGTGRGHARHSRVSETCLGPWNLCPAVSFMEAEEMHWPVPMKAIGAQNLLTMPGGVAK
AGYLHKKGGTQLQLLKWPLRFVIIHQRCIYYFKSSTSASPQGAFSLSGYNRVMRAAEETT
SNNVFPFKIIHISKKHRTWFFSASSEDERKSWMAMLRREIGHFHEKKELPLDTSDSSSDT
DSFYGAVERPIDISLSSYPTDNEDYEHEDEEDSYLEPDSPGPMKLEDALTYPPAYPPPPV
PVPRKPTFSDLPRAHSFTSKSPSPLLPPPPPKRGLMDTGPAPEDAKKDPLGLRRVEPSLR
VPATPRRMSDPPVSNVPTVPNLRKHPCFRDSANPGPEPWTPGHGTSSVSSSTTMAITTSR
NCDKLKSFHLSSRGPPASEPPPVPANKPKFLKIVEEASPREAAKSAPVPPVAPRPPVQKM
SMPEVTVRPAVLPRPEKTPLPHLQRSPPDGQSFRGFSFEKARQPSQADTGEEDSDEDYEK
VPLPNSVFVNTTESCEVERLFKATNPLGEPQDGLYCIRNSSTKSGKVLVVWDESSNKVRN
YRIFEKDSKFYLEGEVLFASVGSMVEHYHTHVLPSHQSLLLRHPYGYAGPR
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgggttttgggaccggtcgtggacatgcgcggcacagtcgtgtctcagagacctgcctg
ggtccctggaacctgtgtcccgctgtgagcttcatggaggctgaggaaatgcattggcct
gtccccatgaaggccattggtgcccagaatttgctgactatgcctggtggtgtggccaag
gctggttacttgcacaagaagggtggcacccagctgcaactgctcaaatggcccctccgc
tttgtgatcatccaccagcgctgcatctactacttcaagagcagcacatctgcctccccg
cagggcgccttctcactgagcggctacaacagagtgatgcgggcagctgaggagaccaca
tccaacaatgtcttcccgttcaagatcattcacatcagcaagaaacaccgcacgtggttc
ttctcagcctcctctgaggacgagcgcaagagctggatggccatgctacgcagggaaatt
ggccacttccatgagaagaaggaactacctctggataccagcgactctagctcagacacg
gacagcttctatggtgcagttgagcgacctatagatatcagcctgtcttcatatcccaca
gacaacgaagattacgaacatgaggatgaagaagactcgtacttggagcctgattccccg
ggacccatgaaacttgaagatgccctgacctatccaccagcctacccaccaccccctgta
cctgtacctcggaagccaaccttctctgacttgccccgtgcccactctttcacctccaaa
agcccaagccccttactgccacccccacctcctaagcgaggccttatggacactggccct
gcccctgaggatgctaagaaggaccccctgggcctgaggcgagtagagcctagcctcagg
gtgcctgctacccctcggaggatgagtgaccccccagtgagcaacgtacccactgtgccc
aacctccggaaacatccttgcttccgagacagtgcgaatcctggcccagaaccctggacc
cctggccacgggactagctctgtctccagctctaccaccatggccattaccacctctagg
aactgtgacaaactcaagtcatttcacctgtcttcccgagggccacctgcatctgagccc
ccacctgtgcctgccaataaacccaagttcctgaagatagttgaagaagcttctccaagg
gaagcagccaagtctgcacctgtgccccctgtggcccccaggcctccggtgcagaagatg
tccatgcctgaggttaccgttcggcctgcagtgctgcctagaccagagaagacacctctt
ccccacctccagcgatcccctccggatggacagagtttcaggggcttctcctttgaaaag
gcccgtcagccctcacaggctgacactggcgaggaggactcagatgaagactatgagaag
gtgccgctgcctaactcagtgtttgtcaacaccacagagtcctgcgaggtggaaaggttg
ttcaaagccacaaaccctctcggagagcctcaggatgggctgtattgtattcggaactcc
tctaccaagtcagggaaggtcttggtcgtgtgggatgaatcttcaaacaaagtgaggaat
tatcgcatctttgagaaggattctaagttctacctggaaggtgaggttctgtttgcaagt
gtgggcagcatggtggagcactaccacacccacgtgctgcctagccaccagagcctgttg
ctgcggcacccgtacggctacgctgggcccaggtga

DBGET integrated database retrieval system