KEGG   Rattus norvegicus (rat): 306257Help
Entry
306257            CDS       T01003                                 

Gene name
Bap1
Definition
BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) (EC:3.4.19.12)
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     306257 (Bap1)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   306257 (Bap1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
16p16
AA seq 740 aa AA seqDB search
MNKGWLELESDPGLFTLLVEDFGKNPFTPDRRALAGVKGVQVEEIYDLQSKCQGPVYGFI
FLFKWIEERRSRRKVSTLVDDTSVIDDDIVNSMFFAHQLIPNSCATHALLSVLLNCSNVD
LGPTLSRMKDFTKGFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEA
FHFVSYVPITGRLFELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIR
FNLMAVVPDRRVKYEARLHVLKGNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKP
ASSKSPFGLEAGRTPAASECTHTDGAEEVAGSCPQTTTHSPPSKSKLVVKPSGSSLNGVP
PTPTPIVQRLPAFLDNHNYAKSPMQEEEDLAAGVGRSRVPVRPQQYSDDEEDYEDEEEDV
QNTSSAIRYKRKGTGKPGSLSNSSDGQLSVLQPNTINVLTEKLQESQKDLSIPLSIKTSS
GAGSPAVAVPTHSQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISK
VLFGEDDSLLRVDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTEGGKGSSPSTRSS
QGSQGSSSLEEKEVVEVTDSRDKSGLNRSSEPLSGEKYSPKELLALLKCVEAEIANYEAC
LKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRL
HKQRKPDRRKRSRPYKAKRQ
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgaataagggctggctggagctggagagtgacccgggcctcttcaccctcctggtggaa
gatttcggtaagaacccctttacccccgatcgtcgggccctggctggtgtcaaaggggtg
caagtggaggagatctatgaccttcagagtaaatgccaggggcctgtatatggatttatc
ttcctgttcaaatggatcgaagagcgcaggtcccgccgcaaggtttctacgttggtggat
gatacatctgtgattgatgatgacatcgtgaatagcatgttctttgctcaccagctgatt
cccaactcttgtgccactcacgccttgctgagcgtgcttctgaactgcagcaatgtggat
ttggggcccacgctgagtcgaatgaaggatttcaccaaaggcttcagccctgagagcaaa
ggatatgcgattggcaatgcccctgaactggccaaggcacataatagccatgccaggcca
gaaccacgtcaccttcctgagaaacagaatggcctcagtgcagtgcggaccatggaggcg
tttcactttgtcagctatgtgcctatcacaggacggctctttgaattggatgggttgaaa
gtctaccctattgatcatgggccctggggagaggatgaggagtggacagataaagcccga
agggtcatcatggagcgaatcggccttgctactgcaggggagccctaccatgacattcgc
ttcaacctgatggcagtggtgcctgaccgcagggttaagtatgaggccaggctgcatgtg
ctgaaggggaaccgacaaacagtcctggaggccctgcagcagctgattagagtaacacag
ccagagctgattcagacccacaaatctcaagagtcacaactgcctgaggagagcaagcca
gccagcagcaagtctccctttgggctagaggcgggcagaaccccggcggcctctgagtgc
actcacacagatggtgcagaggaggtggctggttcgtgcccacaaactacaacccatagt
cctcccagcaaatctaagctggtggtgaagccttcagggagcagcctcaatggggttccc
ccaacccctacccctattgtccagcggctgccagcctttctagataatcacaattatgcc
aaatcccctatgcaggaggaggaagacctggcggcaggtgtgggccgcagccgagttcca
gtccgaccccagcagtactctgatgatgaggaggactatgaggatgaggaggaggatgtg
cagaataccagttctgccatcagatacaagcggaaggggacagggaagccaggatcgttg
agcaattcttcagatgggcagctgtcagtgctgcagcccaacaccatcaatgtcttaact
gagaagcttcaagagtctcagaaagacctttcaattcctctgtccatcaagactagcagt
ggggctgggagtccagccgtggctgtgcccacacactcgcagccttcacccacccctagc
aatgagagcacggacacagcctctgagattggcagtgctttcaactcacccttgcgctca
cccatccgctcagccaacccaacacggccctctagccctgtcacctctcacatctccaag
gtgctctttggagaagatgacagcctacttcgtgttgactgcatacgctacaaccgtgct
gtccgtgacctgggtcctgtcattagcacgggcctgctgcaccttgctgaggatggtgta
ctgagtcccctggcactcacagagggtgggaagggttcctcaccttctaccagatcaagc
caaggcagccaggggtccagcagcctagaggagaaggaggtggtggaagtcacagatagc
agagacaagtctgggctgaacaggtccagtgagcccttgagtggagagaagtactcgccc
aaggagctgttagcactgttaaagtgtgtagaggccgagattgcaaactatgaggcctgt
ctcaaggaggaggtggagaaaaggaagaagttcaagattgatgaccagcgaaggacccac
aactatgatgagttcatctgcaccttcatatccatgctggctcaggaaggaatgctggcc
aacctggtggagcagaacatctcagtgcggcgccgccaaggggtcagcattggtcggctt
cacaagcagcggaagcctgataggcggaaacgctctcgcccctacaaggccaaacgccag
tga

DBGET integrated database retrieval system