KEGG   Rattus norvegicus (rat): 306571Help
Entry
306571            CDS       T01003                                 

Gene name
Kat6a, Moz, Myst3, Runxbp2, Znf220
Definition
K(lysine) acetyltransferase 6A (EC:2.3.1.48)
Orthology
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    306571 (Kat6a)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     306571 (Kat6a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
16q12.5
AA seq 1998 aa AA seqDB search
MVKLANPLYTQWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDNKQSVDWNKLLKRAFEGLAESGGSTLKS
IERFLKSQKDVSAACGGTAASGFHQQLRLAIKRAVGHGRLLKDGPLYRLNTKAANAEGKE
GCESLSCLPPVSLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEDLISCADCGNSGHPS
CLKFSPELTVRVRALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRM
PKGMWICQICRPRKKGRKLLQKKAAQIKRRYANPIGRPKNRLKKQSTVSKGPFSKVRTGP
GRGRKRKITVSSQSASSSEEGYLERIDGLDFCRDSSAPLKFNKKTKGLIDGLTKFFTPSP
DGRKARGEAVDYSELRIRKKGNRKSSTSHWPTDNQDGWESKQESEERLFGSQEIMTERDM
ELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEF
CLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLD
HKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFL
IDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTGV
CPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVIVS
NSVVSEEEDEEADDGEKEEPQGQERELETRERVGKSVSRENKDQDSSSLIESEKKPEVKE
LASSSRLSKQALVRDSLPANSQPPRRGRCGRKNRKTQERFGDKDSKMLVGETLSTSQEQY
GECEEKSAASRERYTEVGEQPAAPQAQADGNPDIPKGRFSESADLWRGQLKKSPETLKCR
LPEGNDRLPCCYTDGDRAVFRGFSESSEEEEEPESPRSNSPPVLTKPTLKRKKPILHRRR
RVRKRKHHNSSVVTETISETTEVLDEPFEDSDSERPMPRLEPTFEIEEEEEEEDENELFP
RGYFHCLSSQDILRCQASSKRTASKDEEEEEEESDDADDTPVLKPVSLLRKCDVNSASLE
PDTSTPMKKKKGWPKGKSRKPIHWKKRPGRKPGFKLNQDIIAVSTQECIVEPIVPIKPGR
KPRTQESEELVEVKEGLVEERKEEMHTEADEEAEEEEDAASSDIRAMSPLDSSNSPDADP
KEPEAEEEEEKPLDDPRQSEEEPQELEEQEQEEEDEVTAEANQNEDHDADDEDDGHLDSL
KTKEPEGQPAREDGTEEPGTQESFLDASIQDSRENAKDKDETEADSEEEQPSHEASVGSE
TMPGSEEDHEEDSNTKEELIELKEEEEIPHSELDLETVQAVQSLTQEESSEHEGAYQDCE
ETLAACQTLQSYTHTDEDPQMSMVEDCHASEHNSPISSIPSHPSQSVRSVSSPSMPALES
GYTQISPEQGSLSAPSMQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPS
SYDSTMGSSICGNNSSQSSCSYGGLSSSSSLTQNSCVVTQQMASMGNSCSMLQQNSVQPA
TNCNIKSPQTCVVERPPSNQQPPPPPPPPPPPQQPQPQPQQQAAPQPPPPQPQQQPPPPP
QQQPQPPPPPQQQPPLSQCSMNNSFTAAPMIMEIPESGGTGNISIYERIPGDFGAGSYSQ
PSATFSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSLSNTGLAQLAPSHPLAGTPQA
QATMTPPPNLAPTTMNLTSPLLQCNMSATNIGIPHTQRLQGQMPVKGHISIRSKSAPLPS
ATAHQQQLYGRSPPAVAMQAGPRALAVQRGMNMGVNLMPTPAYNVNSMNMNTLNAMNSYR
MTQPMMNSSYHSNPAYMNQTAQYPMQMQMGMMGSQAYTQQPMQPNPHGNMMYTGPSHHSY
MNAAGVPKQSLNGPYMRR
NT seq 5997 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagctcgctaacccgctgtacacgcagtggattttggaggccatcaaaaaagtc
aagaagcagaaacagcgaccttcagaagaaagaatatgcaatgcagtgtcgtcctcccac
ggcttagatcggaaaactgtcctggagcagttggagctgagtgttaaagatggcacgatc
ctaaaagtctcaaacaaaggtctcaactcctataaagatcctgataatcctgggcgaata
gcacttcctaaacctcgaaaccatggaaagttggataataaacaaagtgtggattggaat
aaattactcaagcgggcatttgagggcttggcagagtctggtggctcaactttgaaaagt
attgaacgctttttgaaaagccagaaggatgtgtctgctgcctgtggaggcactgctgcc
tctgggtttcaccagcagctgcggttggcgatcaagcgtgccgttggtcatggccgactc
cttaaagatggacctctctaccggctcaacaccaaggcagccaatgctgaagggaaagag
ggctgcgagtcgctctcgtgtttacctcctgtgtcactgcttccacacgagaaagataag
ccggttgctgaaccaatccccatctgtagtttctgtcttggtacaaaagaacaaaaccgg
gaaaagaagcctgaggacctcatctcctgcgcagactgtggcaatagcggtcacccatcc
tgcttaaagttctccccagaactcacagtgagagtgagggccctgcggtggcagtgcatc
gagtgcaaaacgtgcagctcctgtcgcgatcaaggcaaaaacgcagataacatgctcttt
tgtgattcatgtgaccgaggttttcacatggagtgttgtgacccacccctcacacggatg
ccaaaaggcatgtggatatgtcagatatgccgacccaggaaaaaaggacggaaactgcta
caaaagaaggcagcacagataaaacggcgctatgctaatccaataggacgtccaaaaaac
aggttaaagaaacaaagcacggtatcaaaaggtccctttagcaaagttcgaactggtcct
ggaaggggtcggaaacgtaaaatcactgtatccagccagtctgcgtcatcctcagaagaa
ggctatttagagcggatagatggcttggacttctgcagagatagcagtgcccccttgaag
ttcaacaagaaaaccaaagggctcattgatggccttaccaaattcttcaccccttctcct
gatgggcggaaagcccgaggggaggcggtagactactctgagctcagaatcaggaaaaag
ggcaacagaaaatcaagtacttcacattggcccacagacaatcaggacggctgggaaagc
aaacaggaaagtgaggagcggctttttgggagccaagaaatcatgacggaaagagatatg
gaattatttcgtgatatccaagaacaagcactgcagaaagttggagtaactgggccccct
gatccacaagtccgctgtccctccgtcattgagtttgggaagtatgaaatccacacctgg
tattcctctccatatcctcaagaatactcaaggctgcctaaattgtatctttgtgagttc
tgtctaaaatatatgaaaagtagaactattctccagcagcacatgaagaaatgtggttgg
ttccatcctcccgccaatgagatttaccgaaagaataatatttctgtctttgaggttgat
gggaatgtgagtaccatttattgtcaaaatctgtgtctcttggcaaagttgtttcttgac
cacaaaacactctattatgacgtggagccatttctcttctatgttttaacacagaatgat
gtcaagggctgccaccttgttggctacttttctaaagaaaagcactgccaacagaaatac
aatgtctcctgtataatgattcttccccaataccaacgtaagggctacggcaggtttctc
atcgatttcagttatttgttatcaaagcgtgaaggccaagcaggctctcctgagaaacca
ctatcagatctaggtcgtctttcctacatggcttattggaaaagtgtaatcttggagtgc
ctttatcaccagaatgacaaacagatcagcattaagaagctgagtaagctgactggagtc
tgcccgcaagacattacttccacactccaccacctacggatgctggacttccgaagtgac
caatttgtgattatccgccgggaaaaacttatccaggatcacatggcgaagctccagctg
aatcttcgacctgtcgatgtagatccagaatgcttacgctggactccagtcatagtctcc
aactctgtcgtctcagaggaggaggatgaggaggctgatgacggagagaaagaagagccc
caaggccaagaaagagagttagagaccagggaaagggtgggaaagtctgtgtctcgggag
aacaaagatcaggattcttcctctttaatagaaagtgaaaagaaaccagaagtcaaggaa
ctagccagctcttcacgtctgagcaaacaggcccttgtccgggacagtcttcctgcaaat
agccagccacctcggaggggccgctgtgggaggaagaacagaaagacacaggaacgtttt
ggtgataaagattctaagatgcttgtgggtgagacgttatccacttctcaggagcaatat
ggagaatgcgaggagaagtcagcagcctcccgagagcgttacactgaggtgggagagcag
ccagcagcccctcaggcacaagcagacgggaacccagacatccccaagggcaggttcagt
gagagcgcggatttgtggcgaggacagctgaagaaaagccctgagaccctgaagtgccga
ttgccagaagggaatgacagacttccgtgctgctacaccgatggtgacagggctgtcttt
aggggcttcagcgaaagtagtgaggaagaggaggagccagaaagtcctcggtcaaactcg
ccaccagtgctcacaaagcccacgctgaaaagaaagaaaccaattcttcaccgaagaagg
agagtccgcaagcggaaacaccacaatagcagtgtcgtcacagaaacgatctctgagacc
actgaggtgttagatgagccttttgaagactctgactctgagagaccaatgccaagactg
gaacctacattcgagattgaggaggaggaggaggaggaggatgaaaatgagctcttcccc
agagggtactttcattgcttgtcctcacaggacatccttaggtgtcaggcttcctccaag
aggacggcgtctaaagatgaggaggaagaagaggaggagtcagacgatgcagatgacact
cctgtcctaaagccagtatctctcttgagaaaatgtgatgtgaacagtgcttcacttgag
ccagatacctctacacctatgaaaaagaaaaagggatggcccaaaggcaagagccgaaaa
cctatccactggaagaaaaggcctgggcggaaaccaggatttaaattgaatcaggacatc
atagctgtttctacacaggaatgcatagttgagcccatagtccccattaaaccaggacgt
aaacccagaactcaagagagtgaagaacttgttgaggtgaaggagggcctggtggaagaa
aggaaggaggaaatgcatacagaagcagacgaagaggccgaggaggaagaggatgcagcc
agcagtgacattagagccatgtccccattggacagcagcaatagccctgatgcagacccg
aaagaacctgaggcagaagaggaagaggagaagccgttggacgatccgaggcaatcagag
gaagagcctcaagagctggaagaacaggagcaagaggaagaggacgaggtgactgcagag
gcaaaccagaatgaagaccatgatgctgacgatgaggacgacggccacctggattcactg
aagacaaaagagccagaggggcagccggctagagaagacggcacagaggagcccggcacc
caggagtcttttttagatgcaagcatacaggacagcagggagaacgcgaaggataaagat
gaaactgaagcggattctgaagaggaacagccttcccatgaggcttctgtgggatcagag
accatgccaggctctgaggaggaccatgaggaggactcaaacactaaggaagaattaatt
gagctaaaagaggaggaagagatcccacacagtgaactggatctggaaactgtacaggca
gtgcagtctttgactcaagaagaaagcagtgagcatgaaggagcctaccaggactgtgag
gaaactcttgcggcttgccagactctacagagttacacccacactgacgaggaccctcag
atgtcaatggttgaagactgccatgcctcagagcataatagcccaatatcctccattccg
tctcatcctagccagtcagtccgctccgtcagcagccccagcatgcctgccctggagagt
ggctacacacagatcagcccagagcaaggatccctgtccgcaccctctatgcagaacatg
gagaccagccccatgatggatgtgccttccgtatcagaccactctcagcaggtggtagac
agtggcttcagtgacctgggcagcatcgagagcaccacagagaactatgagaacccaagc
agctatgactctaccatgggcagcagtatttgtgggaataactcctctcagagcagctgc
tcctacggtggcctgtcatcttcaagcagcctcacccagaacagttgtgttgtcactcag
caaatggcaagcatgggcaacagctgtagcatgctgcagcaaaacagcgtccaaccagct
accaactgcaacatcaagtcgcctcagacctgtgtggtggaaaggcctcccagtaaccag
cagccgccgccaccaccaccacccccgccgccaccacagcagccgcagccgcagccgcag
cagcaggcagccccacagcctcccccaccacagccgcagcagcagccgccccctccaccg
cagcagcagccccagcccccacctccaccccagcagcagccccctctgtcgcagtgtagc
atgaacaacagcttcactgccgcgccaatgataatggagataccagagtccgggggtact
gggaacatcagcatctacgagaggattccaggggattttggcgctggcagctactctcaa
ccgtcagccaccttcagtctcgccaagttgcagcagctgactaacaccattatggaccct
catgccatgccttacagtcattctccggccgtgacttcctatgcaaccagtgtttctctg
tctaatacgggactggctcagctagctccatctcatcccttagccgggacccctcaagca
caagccaccatgacgccacccccaaacttggcacctactactatgaacctcacgtcacct
ctgctgcagtgcaacatgtctgccaccaacattgggatccctcacacgcagaggttgcag
gggcagatgccagtcaaggggcacatttctatccgttccaagtctgcacctttaccctct
gcaactgcacaccaacagcagctctatggccgcagccccccagcagttgccatgcaggct
ggccctcgtgcactggccgttcagcgtggcatgaacatgggggttaacttaatgcccact
ccagcctataatgtcaattccatgaatatgaacaccttgaatgccatgaacagctatcga
atgacacagcccatgatgaacagcagttaccatagtaaccctgcctacatgaaccagaca
gcacagtatcctatgcagatgcagatgggaatgatggggagccaggcctatacccagcag
cctatgcagccaaaccctcatggaaacatgatgtacactggcccctcccatcacagctac
atgaatgctgccggcgtccccaagcagtcacttaatggaccttacatgagaagatga

DBGET integrated database retrieval system