KEGG   Rattus norvegicus (rat): 306722Help
Entry
306722            CDS       T01003                                 

Gene name
Dapk1
Definition
(RefSeq) death associated protein kinase 1 (EC:2.7.11.1)
  KO
K08803  
death-associated protein kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Pathways in cancer
Bladder cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    306722 (Dapk1)
   05219 Bladder cancer
    306722 (Dapk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     306722 (Dapk1)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: CAMK group
  DAPK family
   306722 (Dapk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
17p14
AA seq 1430 aa AA seqDB search
MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSRED
IEREVSILKEIRHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFL
KQILSGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYDFEEEF
FRNTSTLAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFA
ARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIHAINDDNVPGL
QHLLGSLSSYDVNQPNKHGTPPLLIAAGCGNIQMLQLLIKRGSRIDVQDKGGSNAIYWAS
RHGHVDTLKFLNENKCPLDVKDKSGETALHVAARYGHADVVQLLCSFGSNPDFQDKEEET
PLHCAAWHGYYSVARALCEVGCNVNIKNREGETPLLTASARGYHDIVECLAEHGADLNAS
DKDGHIALHLAVRRCQMEVIKTLLGHGCLVDFQDRHGNTPLHVACKDGSAPIVVALCEAS
CNLDISNKYGRTPLHLAANNGILDVVRYLCLMGANVEALTLDGKTAEDLAKAEQHEHVAG
LLARLRKDTHRGLFIQQLRPTQNLQPRIKLKLFGHSGSGKSTLVESLKCGLLRSFFRRRR
PRLSSTNSTRFPPSPLATKPTVSVSINNLYPGCENVSVRSRSMMFEPGLTKGMLEVFVAP
SHHLHCSTDDQSTKAIDIQNAYLNGVGDFSVWEFSGNPVYFCCYDYFAANDPTSIHIIVF
SLEEPYEIQLNQVIFWLSFLKSLVSVEEPIAFGGKLKNPLRVVLVATHADIMNIPRPAGG
EFGYDKDTSLLKEIRNRFGNDLHVSNKLFVLDAGASGSKDIKVLRNHLQEIRSQIVSGCP
PMTHLCEKIISTLPSWRKLNGPNQLMSLQQFVYDVQDQLNPLASEDDLRRIAQQLHSTGE
INIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTMEDIQRLVPDSDVEE
LLQILDAMDICARDLSSGTMVDIPALIKTDSLQRSWADEEDEVMVYGGVRIVPVEHLTPF
PCGIFHKVQVNLCRWIHQQSTEGDADIRLWVSGCRIANRGAELLVLLVNHGQGIEVQVRG
LETEKIKCCLLLDSVCSTIETVMATTLPGLLTVKHYLSPQQLREHHEPVMVYQPRDFFRA
QTLKESSLTNTMGGYKESFSSITCFGCHDVYSQASLGMDIHASDLSLLTRRKLSRLLDPP
DPMGKDWCLLAMNLGLPDMVAKHNVNTRASRDFLPSPVHALLQEWTSYPESTVGILISKL
RELGRRDAADFLLKASSVFKINLDGNGQEAYASSCNSGTSYNSISSVVSR
NT seq 4293 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgttcaggcaggaaaacgtggacgactactacgacaccggcgaggaactgggc
agcggacagttcgccgttgtgaagaaatgtcgtgagaaaagtaccggtcttcagtatgcg
gccaagttcatcaagaaaaggaggaccaagtccagccggcggggcgtgagccgagaggac
atcgagcgggaggtcagcatcctgaaggagatccggcacccaaacgtcatcaccctgcat
gaggtctacgagaacaagacagacgtcattctgatcctggagcttgttgcaggaggcgag
ctgtttgacttcctggctgagaaggaatctctcactgaagaagaagcaaccgagttcctc
aagcagatcctcagcggcgtttactacctgcactcgcttcaaatcgcccactttgacctg
aagccggaaaacataatgcttctggatagaaatgtgcccaaacctcggatcaagatcatc
gacttcggcctggcccataaaattgactttggaaatgaattcaaaaacatatttgggaca
ccagagtttgtggctccggagatcgtcaactatgagccccttggtcttgaggcagacatg
tggagcattggggtaataacctatatcctcctaagcggggcctccccttttcttggagac
accaagcaagaaacattagcgaatgtatctgctgtcaactatgactttgaggaggaattc
ttccgcaacaccagtacccttgccaaagatttcatcagaaggctgctggtcaaggatcca
aagaagaggatgacaatccaggacagtttgcagcacccctggatcaagcctaaagacacc
caacaagcacttagtcgaaaagcctcagcagtaaacatggagaaattcaagaagtttgca
gctcggaaaaaatggaaacaatctgttcgcttgatatcactgtgccaaagattatccagg
tcatttttgtccagaagtaacatgagcgttgccaggagcgatgatactctggatgaggaa
gactcctttgtgatgaaagccatcattcatgccatcaatgatgacaacgtccccggcctg
cagcacctcctgggctcattgtccagctatgatgtcaaccagcccaacaagcacgggaca
cctccattactgattgctgcaggctgtgggaatattcagatgttacagttactcataaaa
cggggctcaaggatcgacgtccaggataagggaggatccaatgctatctactgggcctct
cggcatggccatgtggatactttgaagtttctcaatgagaacaaatgccctttggatgtt
aaagacaagtctggagagacagctcttcacgtggcagcccgctatggccatgcagatgtg
gttcaactcttgtgcagttttggctctaatcctgatttccaggacaaggaagaggaaacc
cccctgcactgtgctgcctggcacggctattactccgtggctagagctctttgtgaagtt
ggctgtaacgtgaatatcaagaaccgggagggagagaccccactgctgacagcttctgcc
aggggctaccatgacattgtggagtgtctggctgaacatggagctgacctgaatgcttct
gacaaggatgggcacatcgcccttcatcttgctgtgaggcgctgtcagatggaggtcatc
aagaccctccttggccatgggtgccttgtggatttccaggatcggcatggcaacaccccc
ctgcatgtggcctgcaaagatgggagcgcgcccatcgtggtggccctctgtgaagccagc
tgcaacctggacatctcaaacaagtatggtcggactcctctccaccttgcagccaacaac
gggatcctagatgtggtccgctacctctgcctgatgggcgccaacgtggaggctctgacc
ttggatggcaagacggccgaggacctcgccaaggcagagcagcacgagcacgtggcaggg
ctcctggcaagactgcggaaggacacacaccgagggctcttcatccagcagctccgaccc
acgcagaatctccagcccagaatcaagctcaaactgtttggccactcgggatcggggaaa
tccacactggtggaatctctcaagtgtgggctgttaaggagtttcttcagaaggcgccgg
cccagactgtcctctaccaactccacccgcttcccaccgtcgcccctggctactaagcca
acagtctcagtgagcattaacaacctgtaccccggctgtgagaatgtgagcgtgaggagc
cgaagcatgatgtttgagccaggcctcaccaaagggatgctggaagtgttcgtggctccg
tctcaccacctacactgctcgaccgatgaccagtccaccaaagccatcgacatccagaat
gcttacttgaacggagttggtgatttcagcgtatgggagttctctggaaaccctgtgtac
ttctgttgctatgactacttcgccgccaacgatcccacatccatccacatcatcgttttc
agtctcgaagaaccctatgagatccagctgaaccaagtgattttctggcttagtttcttg
aagtctctggtctcagttgaagaacccatagcatttggaggcaagctgaagaaccctctc
cgagttgtcctggtggccacacatgctgacatcatgaacatccctcggcctgctgggggc
gagtttggatatgataaagatacatccttgctgaaagagatcaggaacaggtttgggaat
gaccttcatgtctcaaataagctgtttgtgctggatgcaggagcatctgggtctaaggac
atcaaggttctccggaatcacctgcaagaaatacggagtcagattgtctcggggtgccct
cccatgactcatctgtgtgagaagatcatctccactctgccctcctggcggaagctcaac
gggccaaaccagctgatgtcgctccagcagtttgtgtatgacgtgcaggaccagctgaac
cccctggcctccgaggatgacctcaggcgcattgcacagcagctgcacagcacgggagag
atcaacatcatgcagagtgagacagtgcaggatgtgttgctgctggatcctcgatggctc
tgcaccaacgtcctggggaagctgctgtctgtggagactccccgagccctgcaccattat
cggggccgctacaccatggaagatatccagcgtctggtccccgacagtgacgtggaggag
ctgctgcagatcctggatgccatggatatctgcgcccgagacctgagtagcgggactatg
gtggatatccctgctctaatcaaaacagacagcctgcagcgctcctgggccgatgaggaa
gacgaggtgatggtgtacggaggtgtgcgcatcgtccctgtagagcacctcactcccttc
ccctgtggcatctttcacaaagttcaggtcaacctgtgccggtggatccaccagcagagc
actgagggggacgcggacatccgtctgtgggtgagcggctgcaggatcgccaaccgtggg
gctgagttgctggtgctgctggtcaatcacggtcagggcattgaggtacaggtgcgtgga
ctggagaccgagaagattaagtgctgcctgctgctggactcggtgtgcagcaccatcgag
actgtcatggccaccaccttgccagggctgttgacggtgaagcactacctgagcccccag
cagctaagggagcatcacgaaccagtcatggtctaccagccccgggacttcttccgtgcg
cagaccctgaaagagagctccctcaccaacaccatgggagggtacaaggagagcttcagc
agcatcacgtgctttgggtgtcacgatgtctactcacaggccagtcttggcatggacatc
catgcatcagacctgagtctcctgacccggaggaaactgagtcgtcttcttgacccaccg
gaccccatggggaaggactggtgccttctggccatgaacttgggcctcccggacatggtg
gccaaacacaacgtcaataccagggcttctagggatttcctccccagcccagtgcatgcc
ttgctacaggaatggacctcctaccctgagagcacggtgggcatccttatatccaaactt
cgggagctggggcgccgggatgctgcggactttttactgaaggcctcctctgtgttcaag
atcaaccttgacggcaatggccaggaggcctatgcctcaagctgtaacagtggcacatcc
tacaattccataagctcagtggtgtcccggtga

DBGET integrated database retrieval system