KEGG   Rattus norvegicus (rat): 306817Help
Entry
306817            CDS       T01003                                 

Gene name
Dek
Definition
(RefSeq) DEK proto-oncogene
  KO
K17046  
protein DEK
Organism
rno  Rattus norvegicus (rat)
Brite
Chromosome [BR:rno03036]
 Eukaryotic Type
  Chromatin remodeling factors
   B-WICH complex
    306817 (Dek)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
Ensembl: 
UniProt: 
Position
17p14
AA seq 378 aa AA seqDB search
MSAAAAPAAEGEDTPTPPASEKEPEMPGPREESEEEEEEDDDDEDEEEEKEKSLIVEGKR
EKRKVERLTMQVSSLQREPFTIAQGKGQKLCEIERIHFFLSKKKTDELRNLHKLLYNRPG
TVSSLKKNVGQFSGFPFEKGSTQYKKKEEMLKKYRNAMLKSICEVLDLERSGVNSELVKR
ILNFLMHPKPSGKPLPKSKKSSSKGSKKERNSSGTTRKSKQTKCPEILSDESSSDEDEKK
NKDESSEDEEKESEEEQPPKKTSKKEKAKQKATTKSKKSVKSANVKKADSSTTKKNQNSS
KKESGSEDSSDDEPLIKKLKKPPTDEELKETVKKLLADANLEEVTMKQICKEVYENYPAY
DLTERKDFIKTTVKELIS
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcggcggcagcccccgctgcggagggagaggacacccccacgccgcccgcgtcc
gagaaggaacctgagatgccgggtcccagggaggagagtgaggaggaagaggaggaggac
gacgacgatgaggatgaggaggaagaaaaagaaaagagccttatcgtggagggcaagaga
gagaagaggaaagtagagaggctgacgatgcaggtgtcttccttacagagagagccgttc
acaatcgcacaagggaagggtcagaaactttgtgaaattgaaaggatacatttctttctg
agtaagaaaaaaacagatgaacttagaaatctacacaaactgctttacaacaggccgggc
acagtgtcctctttgaagaagaatgtgggtcagttcagtggctttccatttgaaaaaggc
agtacccagtataaaaagaaggaagaaatgttgaaaaagtatagaaacgccatgttaaag
agcatctgtgaggttcttgatctagagaggtcaggtgtgaacagtgaactagtgaagagg
atcttgaatttcttaatgcatccaaagccttctggcaaaccattgccaaaatccaaaaaa
tcttccagcaaaggtagtaaaaaggaacggaacagttctggaacgacaaggaagtcaaag
caaactaaatgtcctgaaattctgtcagatgagtctagtagtgatgaagatgagaagaaa
aacaaggacgagtcttcagaagatgaagagaaagaaagtgaagaggagcaaccaccaaaa
aagacatctaaaaaagaaaaagcaaaacagaaagctaccactaaaagtaaaaaatctgtg
aagagtgctaatgttaagaaggcggacagcagcaccaccaagaagaaccaaaacagttcc
aaaaaagagtctggatctgaagatagttctgatgatgaacctttaattaaaaaattgaaa
aagccacctacagatgaagaactaaaggagactgtgaagaagttactggctgatgcgaac
ctggaagaagtcacaatgaagcagatttgcaaagaggtatatgaaaattatcctgcgtat
gatttaactgagaggaaagatttcattaaaacgactgtaaaagagctaatctcttga

DBGET integrated database retrieval system