KEGG   Rattus norvegicus (rat): 306945Help
Entry
306945            CDS       T01003                                 

Gene name
Hist1h2bh
Definition
histone cluster 1, H2bh
Orthology
K11252  
histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    306945 (Hist1h2bh)
  Immune diseases
   05322 Systemic lupus erythematosus
    306945 (Hist1h2bh)
  Substance dependence
   05034 Alcoholism
    306945 (Hist1h2bh)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   306945 (Hist1h2bh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
17p11
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcctgcgaaatctgctcccgccccgaagaagggctccaagaaggcagtcacc
aaggcgcagaagaaggatggcaagaagcgcaagcgcagccgcaaggagagctactctgtg
tacgtgtacaaggtgctgaagcaagtgcacccggacacaggcatctcttccaaggccatg
ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ttggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacagccgtgcgc
ctgctactgcccggtgaattggccaagcacgccgtttccgagggcaccaaggcggtcacc
aagtacaccagctccaagtaa

DBGET integrated database retrieval system