KEGG   Rattus norvegicus (rat): 307511Help
Entry
307511            CDS       T01003                                 

Gene name
Cdc25c
Definition
cell division cycle 25C (EC:3.1.3.48)
Orthology
K05867  
M-phase inducer phosphatase 3 [EC:3.1.3.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
MicroRNAs in cancer
Class
Cellular Processes; Cell growth and death; Cell cycle [PATH:rno04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:rno04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:rno04914]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:rno05206]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
18p12
AA seq 261 aa AA seqDB search
MKNLGSPITTVPKLSKNLKLEDQEGISEDPMECSLEDQDAKGLSLKKTVPLCGMDAIELE
EEDSDSEHLTGDFSKACVLPTVPGKHQDLKYISPDTVAALLSGKFQSVIERFYIIDCRYP
YEYLGGHILGALNLYSQKELYEFFLKKPVVPEDTQKRVIIVFLCEFSSERGPRMCRSLRE
KDRALNQYPALYYPELYILRGGYRDFFPEYMELCEPQGYCPMLHQDHQAELLSWRSQSKA
QEGERQLREQIALLVKNVSPQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatctgggcagtcccattactacagttccaaaactgagtaaaaatctcaagcta
gaagaccaagaagggatttcagaagacccaatggagtgttccctggaagaccaagatgcc
aagggcttaagtctgaagaagacggtccctctctgtggcatggatgccattgagttggag
gaggaagattctgactcagagcatctgactggtgatttctcaaaggcgtgtgtactgcca
acggtgccagggaaacaccaggatctgaagtatatcagcccagatacagtggctgcattg
ctgtctgggaagttccagagtgtgatcgagaggttttatatcattgattgccgttatccg
tatgagtacctgggaggacacattctgggagccttaaacctgtacagtcagaaggaacta
tacgagttctttctgaagaagcctgttgtccctgaggacacccagaagagagtcatcatt
gtgttcctctgtgaattctcctcagagagaggcccacgaatgtgccgttctctgagagaa
aaagacagggctctgaaccagtatccagcattatactaccctgagctgtatatcctcaga
gggggctacagagatttctttccagaatatatggagctgtgtgaaccccagggctactgt
cctatgcttcaccaggaccaccaggccgagctgctgagctggcgcagccagagcaaagcc
caggaaggggagcggcagctgcgagaacagattgccctcctggtgaagaatgtgagccct
caatag

DBGET integrated database retrieval system