KEGG   Rattus norvegicus (rat): 307511Help
Entry
307511            CDS       T01003                                 

Gene name
Cdc25c
Definition
cell division cycle 25C (EC:3.1.3.48)
Orthology
K05867  
M-phase inducer phosphatase 3 [EC:3.1.3.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    307511 (Cdc25c)
   04114 Oocyte meiosis
    307511 (Cdc25c)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    307511 (Cdc25c)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    307511 (Cdc25c)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     307511 (Cdc25c)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     307511 (Cdc25c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
18p12
AA seq 261 aa AA seqDB search
MKNLGSPITTVPKLSKNLKLEDQEGISEDPMECSLEDQDAKGLSLKKTVPLCGMDAIELE
EEDSDSEHLTGDFSKACVLPTVPGKHQDLKYISPDTVAALLSGKFQSVIERFYIIDCRYP
YEYLGGHILGALNLYSQKELYEFFLKKPVVPEDTQKRVIIVFLCEFSSERGPRMCRSLRE
KDRALNQYPALYYPELYILRGGYRDFFPEYMELCEPQGYCPMLHQDHQAELLSWRSQSKA
QEGERQLREQIALLVKNVSPQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatctgggcagtcccattactacagttccaaaactgagtaaaaatctcaagcta
gaagaccaagaagggatttcagaagacccaatggagtgttccctggaagaccaagatgcc
aagggcttaagtctgaagaagacggtccctctctgtggcatggatgccattgagttggag
gaggaagattctgactcagagcatctgactggtgatttctcaaaggcgtgtgtactgcca
acggtgccagggaaacaccaggatctgaagtatatcagcccagatacagtggctgcattg
ctgtctgggaagttccagagtgtgatcgagaggttttatatcattgattgccgttatccg
tatgagtacctgggaggacacattctgggagccttaaacctgtacagtcagaaggaacta
tacgagttctttctgaagaagcctgttgtccctgaggacacccagaagagagtcatcatt
gtgttcctctgtgaattctcctcagagagaggcccacgaatgtgccgttctctgagagaa
aaagacagggctctgaaccagtatccagcattatactaccctgagctgtatatcctcaga
gggggctacagagatttctttccagaatatatggagctgtgtgaaccccagggctactgt
cctatgcttcaccaggaccaccaggccgagctgctgagctggcgcagccagagcaaagcc
caggaaggggagcggcagctgcgagaacagattgccctcctggtgaagaatgtgagccct
caatag

DBGET integrated database retrieval system