KEGG   Rattus norvegicus (rat): 307660Help
Entry
307660            CDS       T01003                                 

Gene name
Ces5a, Ces5, Ces7
Definition
carboxylesterase 5A (EC:3.1.1.1)
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     307660 (Ces5a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
19p12
AA seq 575 aa AA seqDB search
MSGDWVHTGQALIWVLWIFAAIIRGSVTEEPHRYTRLGWVQGKQATVLGRLEPVNVFLGI
PFAAPPLGPLRFSNPQPPIPWHDLREATTYPNVCFQNLEWLFIYQNLLKVHYPKLGVSED
CLYLNIYAPAYANDGSRLPVMMWIPGGGFETGSASIFDGSALAAYEDVLIVTIQYRLGIF
GFFNTQNQHAPGNWAFQDQLAALQWVRENINYFGGNPDSVTIFGGSAGAISISSLILSPL
SAGLFHRAIMQSGVAIIPSLKNFDDELKHGLQVVADVCKCNVSDSKVLLKCLREKSSLEL
LSLGQKTKAFTRVVDGSFFPEEPMELLSQKTFKTVPSIIGVNNQECGYILPMREAPEILF
GSNESTALTLIHVLLHIPPQYMHIVAKDYFHGKHSLTDIRDTLLDLFGDVFFVVPGLVTA
RNHRDADGPVYFYEFQHRPNCFQNTRPAFVKADHTDEIRFVFGGPFLEGDVVMFEEATED
EKLLSRKMMSYWANFARSGDPNGDDLPLWPAYDQNESYLKLDVNISTGWRLKDRRVEFWT
DTLPLIMSASKALLSPTFPLILFSLLPPSLLSIAS
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgagtggggactgggtgcatacaggccaggccctaatctgggtcctttggatctttgca
gccatcatcagggggtctgtgactgaagagccacataggtataccaggctgggatgggtg
caggggaagcaagccactgtgctgggaagacttgaacctgtgaacgtgtttcttgggatc
ccctttgctgcaccccctcttggacctctgcggttttccaatccacagcctccgatccca
tggcacgatttgcgagaagccactacctatcccaatgtgtgctttcagaacttagagtgg
ctcttcatatatcaaaacctgctcaaagtacattaccctaaacttggagtgtcagaggac
tgtctgtacctcaacatttatgcaccagcctacgccaatgatggctcccgtctcccggtc
atgatgtggatacctggaggtggctttgagactggctcggcctccatcttcgatgggtct
gccctggctgcctatgaggacgtgttgattgtgaccatccagtaccgcctaggaatattt
ggattcttcaacacacagaaccagcatgcccctgggaactgggccttccaggatcagttg
gctgccttgcaatgggttagggagaacatcaactacttcggtggaaaccctgactctgtg
accatctttggtggctcggcaggagccataagcatttctagcctcattctgtctcctttg
agcgcggggttattccacagagccatcatgcagagcggggtggccatcatccccagcctg
aagaattttgatgatgaactgaaacacggtttgcaggtggttgcggatgtctgtaagtgc
aacgtatcagactccaaggttttgctgaagtgcctgagggaaaagtcttctctcgagttg
ctgagccttggccagaaaacaaaggcattcactcgagtggttgatggttctttctttcct
gaagaaccgatggaactgttgtctcaaaagacatttaaaacagttccttctatcattgga
gtcaataaccaggagtgtggctacatactgcccatgagggaagcgcctgagattcttttc
ggctccaatgagtctaccgctctcaccctgatacatgtcttgctgcatattcccccccag
tatatgcacatcgtggcaaaagattacttccacggcaagcattctctgactgacatccga
gacactttactggatttgtttggagatgtgttctttgtggttcctgggctggttacagct
cgaaatcacagagatgctgatggacctgtctatttttatgagtttcagcaccgacccaac
tgctttcagaacacaaggccagctttcgtgaaggctgaccacacggatgaaatccgcttt
gtctttggaggcccattcctggagggtgacgtggtcatgtttgaggaagccactgaggat
gagaagttgctaagcaggaagatgatgagctactgggctaactttgccaggagtggggat
cctaacggggatgacctgcctctgtggccagcctacgatcagaatgaatcgtacctgaag
ctggatgtgaacatcagcactggatggagactgaaagatcggagagtggaattttggaca
gacaccctgcccctgatcatgtctgcttccaaagcgctactcagtcccactttcccctta
atcctcttttcgctgctgccgccgtctcttctctccattgcttcttag

DBGET integrated database retrieval system