KEGG   Rattus norvegicus (rat): 307764Help
Entry
307764            CDS       T01003                                 

Gene name
Usp38
Definition
ubiquitin specific peptidase 38
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     307764 (Usp38)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   307764 (Usp38)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
19q11
AA seq 1041 aa AA seqDB search
MDKILEGLVSSSHPLPLKRMIVRKVVESAEHWLDEAQCEAMFDLTTRLILEGQDPFQRQV
GHQVLEAYARYHRPEFESFFNKTFVLGLLQQGYHSLDRKDVAILDYIHNGLKLIMSCPSV
LDLFSLLQVEVLRMVCERPEPLLCARLSDLLTDFVQCVPKGKLSITFCQQLVRTIGHFQC
VSTQEKELREYVSQVTKVSNLLQNIWKAEPSTLLPSLQEVFASISSTDASFEPSVALASL
VQHIPLQMITVLIRSLTTDPNVKDASMTRALCRMIDWLSWPLAQHVDTWVIALLKGLAAV
QKFTILIDVTLLKIELVFNRLWFPLVRPGALAVLSHMLLSFQHSPEAFHVIVPHIVNLVH
SFRSDGLPSSTAFLVQLTELVHCMMYHYSGFPDLYEPILEAVKDFPKPTEEKIKLILNQS
AWTSQSNALASCLSRLSGKSETGKTGLINLGNTCYMNSVLQALFMATEFRRQVLSLNLNG
CNSLMKKLQHLFAFLAHTQREAYAPRIFFEASRPPWFTPRSQQDCSEYLRFLLDRLHEEE
KILRIQSSHKPSEGLGCTETCLQEVTNKVAVPSESPSTGGSEKTLIEKMFGGKLRTHICC
LNCRSTSHKVEAFTDLSLAFCPSPSVEDSSFQDPASLPSAQDDGLMQTSVTDAEEEPVVC
NPAAAAFVCDSVVNERRLGSPPVEFPCAKNSSVPGESAKILVSKDVPQNPGGESTTSVTD
LLNYFLAPEVLTGENQYYCESCASLQNAEKTMQITEEPEYLILTLLRFSYDQKYHVRRKI
LDNVSLPLVLELPVKRTSLSSLSEGWSADADFTDVNENLAKKLKPSGTEEAFCPKLVPYL
LSSVVVHSGVSSESGHYYSYARNITGTESSYQMRPQSESLSLTPSQSSLLGGESPNTVIE
QDLENKEMSQEWFLFNDSRVTFTSFQSVQKITSRFPKDTAYVLFYKKQSRTNGVRSDNPA
SGVWVNGEPPLQKELMDAITKDNKLYLQEQELNARARALQAASASCSFRPNGFDDNDPPG
SCGPTGGGGGGGFNAVGRLVF
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atggacaagattctggagggtctggtgagttcctcgcacccgctgcccctcaagcggatg
attgtgcggaaggtggtggaatccgcggagcattggctcgacgaggcgcagtgcgaggcc
atgtttgacctgacgacccgcctcatcctggagggccaggaccccttccagcgacaagtg
ggccaccaggtgctggaggcctacgcgcggtaccaccggccggagttcgagtccttcttc
aacaagactttcgtgttgggcctccttcagcagggctaccactcactggacaggaaggac
gtagccatcctggactacattcacaacggcctgaagctgattatgagctgcccgtcggtg
ctggacctcttcagcctgttacaggtggaggtcttacgaatggtttgcgagaggccggag
ccactactctgtgccaggctgagcgacctcctgacggatttcgtgcagtgcgtccccaaa
gggaaactgtccattaccttctgtcaacagctggttcggacgataggtcacttccagtgt
gtgtccacccaggagaaggagctccgggagtatgtctcccaggtaacaaaagtgagtaac
ttactacagaatatttggaaggctgagccctccacgctgctaccttctctgcaagaagtt
tttgcaagcatctcttccacagatgcgtcctttgagccctcggtggccttggcaagcctg
gtgcagcatattcctctgcagatgatcacggtcctcatcaggagcctgaccaccgaccca
aacgtgaaggatgcaagcatgacccgagctctctgcagaatgattgactggctgtcctgg
ccattggctcagcatgtggatacatgggtaattgctctcctgaagggactggcagctgtt
cagaagtttactattttgatagatgttactttgctgaaaatagaactggtttttaatcga
ctttggtttcctcttgtgagacctggtgctcttgcagtcctctctcatatgctgcttagt
tttcagcattctccagaggcattccatgtgattgtccctcatatagttaacttggttcac
tccttcagaagtgatggcctgccttccagcacagccttcttagtgcagttaacagagctg
gttcactgtatgatgtaccattattctgggtttccagatctctatgagcctattctggag
gcggtgaaggattttcctaagcccactgaagagaagattaagttgattctcaatcaaagt
gcctggacttctcaatccaacgctttggcatcttgcttgtctagactttctggaaaatct
gaaactgggaaaactggtcttattaacctgggaaacacgtgttacatgaacagtgtttta
caagcattgtttatggctacagagttcagaagacaagtattatctttaaatctaaatggg
tgtaattccttaatgaaaaaattacaacatctttttgcttttttggctcatacacaaagg
gaagcatacgcacctcggatattttttgaggcttccagacctccgtggtttactcccagg
tcacaacaggattgctctgagtacctcaggtttctgctggacagactccatgaagaagaa
aagatcttacgaattcagtcctcacataagccttctgaaggtctgggctgtactgaaact
tgtttacaagaagtaaccaataaggtagctgtgccctcagagtcccctagcacaggtggc
agtgagaagactctaatagagaaaatgtttggagggaaactacggactcacatctgctgc
ctgaactgcaggagtacctcacacaaagtggaagccttcacagatctttcgctagccttc
tgtcctagcccttctgtggaagactcgtctttccaagacccagcttcgctacccagtgca
caagatgatgggctaatgcaaaccagtgtcactgacgcagaagaagagccagtagtttgt
aacccagcagcagctgcctttgtttgtgactcagttgtgaatgaaagacgattgggcagt
cctcctgttgagtttccctgtgccaaaaactcttctgtccctggggaatctgcaaagatt
cttgtcagtaaagatgtacctcagaacccaggaggtgagagcacaacttcggtgactgac
ttactgaactactttttggctcccgaggttctgactggtgagaaccaatattactgtgag
agctgtgcctctctacagaatgcagagaagactatgcagatcacagaggagcctgagtac
cttatccttacgctcctgagattctcctatgatcagaagtaccacgtgagaagaaagatt
ttagacaatgtgtcactgccgctggttttggagttgcccgttaaaaggacttccctctct
tccttgtcggaaggttggtctgcagatgctgacttcactgatgttaatgagaacctagct
aaaaaattaaaaccttctgggactgaagaagctttctgccccaaattagtgccctaccta
ttaagttctgttgttgtgcactctggtgtgtcctctgaaagtggccattactattcttat
gccagaaacatcacaggtacagagtcttcctaccagatgcgcccccagtctgaaagtctg
tcattaacaccctcccagagtagtttattagggggagaaagccccaatacagtcattgaa
caggacttggaaaataaggaaatgtcacaagagtggtttttatttaatgacagcagggtg
acatttacttcatttcagtcagtccagaaaatcacaagtaggtttccaaaagacacagcg
tacgtgcttttctacaaaaagcaaagcagaactaatggtgtacgcagtgacaatccagcc
agtggcgtctgggtcaatggagagccaccactacagaaagagctcatggatgccataaca
aaggacaacaaactgtatttgcaggaacaagaattgaatgctcgagcccgggccctacaa
gctgcgtcagcgtcatgctcctttcggcccaatggatttgacgacaatgacccaccagga
agctgtgggccgacgggtggagggggcggaggaggatttaacgcagttggcagactcgtc
ttttga

  All links  
No link information was found.   
DBGET integrated database retrieval system