KEGG   Rattus norvegicus (rat): 307905Help
Entry
307905            CDS       T01003                                 

Gene name
Usp10
Definition
ubiquitin specific peptidase 10 (EC:3.4.19.12)
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     307905 (Usp10)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   307905 (Usp10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
19q12
AA seq 794 aa AA seqDB search
MALHNPQYIFGDFSPDEFNQFFVTPRSSVELPPYSGTQCGIQAEEELLDGQEHQRIEFGV
DEVIEPSDGLQRAPSYSISSTLNPQAPEFILGCPTSKKTPDDIEKDETYSSIDQYPASAL
ALESSSNAEAETLENDSGAGGLGQRERKKKKKRPPGYYSYLKDGSEEGASPAALVNGHAT
SVGTNSEGVEDPEFMVDMLPSVMPRTCDSPQNPMDLISDPVPDSPFPRTLGGDARTAGLP
EGCRETDFEQPCLPTDNLLRTAVTQPNAGADTTENLAVANGKILESLGEGTAAANGVELH
TDESADLDPAKPESQSPPAESALSVSGAISISQPAKSWASLFHDSKPSSSSPVAYVETKC
SPPVPSPLASEKQMEVKEGLVPVSEDPVAIKIAELLETVTLVHKPVSLQPRGLINKGNWC
YINATLQALVACPPMYHLMKFIPLYSKVQRPCTSTPMIDSFVRLMNEFTNMPVPPKPRQA
LGDKIVRDIRPGAAFEPTYIYRLLTVIKSSLSEKGRQEDAEEYLGFILNGLHEEMLSLKK
LLSPTHEKHSVSNGPGSHLIEDEELEDTGEGSEDEWEQVGPKNKTSVTRQADFVQTPITG
IFGGHIRSVVYQQSSKESATLQPFFTLQLDIQSDKIRTVQDALESLVARESVQGYTTKTK
QEVEVSRRVTLEKLPPVLVLHLKRFVYEKTGGCQKLVKNIEYPVDLEISRELLSPGVKNK
NFKCHRTYRLFAVVYHHGNSATGGHYTTDVFQIGLNGWLRIDDQTVKVINQYQVVRPSAD
RTAYLLYYRRVDLL
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggccctccacaacccacagtatatttttggcgatttcagccctgatgaattcaatcag
ttttttgtgactccccgctcttcagtcgagctccctccatacagtgggactcagtgtggc
attcaggctgaagaggaacttctggacggacaagaacatcagaggattgagtttggtgta
gacgaagtcatcgaacccagtgatggtctgcagagagcccctagctacagtatttcaagc
accttgaaccctcaggcacctgaatttatccttggttgtccaacttccaagaagacccct
gatgacatagaaaaagacgagacctacagctccattgatcagtacccggcctcagccttg
gctctggaaagcagctctaacgcagaggccgagaccttggagaatgacagtggcgctggt
ggtcttggtcagagggagcggaagaagaagaagaagcggccccctgggtactacagttat
ctgaaagatggtagtgaagagggtgcttccccggccgcccttgtcaacggccatgccacg
tcagtgggcacgaacagcgagggtgtggaggatcctgagttcatggtggacatgcttcct
tcagtcatgcccaggacttgtgacagccctcagaaccccatggacttaatcagtgaccct
gtccctgatagtcctttccccaggacactaggtggtgatgccaggactgcaggactgcct
gagggctgccgtgaaactgactttgagcagccctgcctccctacagacaacctgctaagg
acagctgtgacgcagcccaacgctggcgccgacactactgagaacctcgcagttgctaat
ggaaaaatacttgaatccttgggcgagggcactgctgctgccaatggggtagagctgcac
actgatgagagtgcagacttggaccctgcgaagcctgagagccagtcacctcctgccgaa
agtgcgctctctgtctctggcgccatttccattagccaacctgcaaagtcctgggctagc
ctctttcatgattctaagccttcttcctcctcacccgtggcgtatgtggaaactaagtgt
tccccccctgtcccgtcccccctggcctctgaaaaacagatggaagtcaaagaagggctt
gttcccgtgtcagaggaccccgtagccataaagattgcagagttattggagactgtaacc
ctagtacataagccagtgtcattgcaaccccgtgggctgatcaataaaggaaactggtgc
tacattaatgccaccctgcaggcattggtggcttgccctccgatgtatcacctgatgaag
ttcattcctctgtactcaaaagtgcaaaggccgtgcacgtccacgcccatgatagatagc
tttgttcggctcatgaacgagtttactaatatgccagtacctcccaaaccccgccaagct
cttggggataaaatcgtgagagatatccgcccaggagctgcctttgaacccacatacatt
tatcgactcctgacagtcatcaagtcgagcctgtctgaaaagggccgacaggaggacgcc
gaggagtacctaggcttcatcctcaatggactccacgaggagatgctgagcctgaagaag
cttctctcacccacgcacgaaaagcactctgtttctaatgggcccggaagccacttgata
gaggatgaggagctggaagacacaggcgagggcagtgaggacgagtgggagcaagtgggt
cccaagaacaagacgtctgtcacccggcaggcggatttcgttcagacgcctatcactggc
attttcggtggacacatcaggtctgtggtttaccagcagagttccaaagaatctgccacg
ctgcagccatttttcacactgcagttggacatccagtccgacaagattcgcacagtccag
gatgccttggaaagcttggtggcaagagagtctgtccagggctacaccaccaagaccaag
caggaggttgaagtcagccgtagagtgactctggagaagcttccccctgtccttgtgctc
cacctgaagcgcttcgtctatgagaagacgggcggatgccagaagctcgtcaagaacatc
gagtaccctgtggacttggagatcagcagagaactgctttctccaggcgtcaaaaataaa
aactttaaatgccacagaacctataggctgttcgcagtggtctaccatcatggcaacagt
gctacaggtggccactacaccacggacgtcttccagattgggcttaacggctggctgcga
attgatgaccagacggtcaaggttatcaaccagtaccaggtggtgagaccaagtgctgac
cgcaccgcctacctcctgtattaccgccgtgtggacctgctgtag

DBGET integrated database retrieval system