KEGG   Rattus norvegicus (rat): 308022Help
Entry
308022            CDS       T01003                                 

Gene name
Mcoln3
Definition
(RefSeq) mucolipin 3
  KO
K04994  
mucolipin 3
Organism
rno  Rattus norvegicus (rat)
Brite
Ion channels [BR:rno04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPML (Mucolipin)
   308022 (Mcoln3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
UniProt: 
Position
2q44
AA seq 553 aa AA seqDB search
MANPEVVVSSCSSHQDESPCTFYPSSSQSEQLLLEDQMRRKLKFFFMNPCEKFWARGRKP
WKLAIQILKIAMVTIQLVLFGLSNQMVVAFKEENTIAFKHLFLKGYMDRMDDTYAVYTQN
DVYDQIIFAVTRYLQLRNISVGNHAYENKGTKQSAMAVCQHFYRQGTICPGNDTFDIDPE
VETDCFLIEPEEAFHMGTPGENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYD
FTLTITFDNKAHSGRIKISLDNDISIRECKDWHVSGSIQKNTHYMMIFDAFVILTCLSSL
VLCARSVIRGLQLQQEFVNFFLLHYKKEVSASDQMEFINGWYIMIIVSDILTIVGSILKM
EIQAKSLTSYDVCSILLGTSTMLVWLGVIRYLGFFAKYNLLILTLQAALPNVIRFCCCAA
MIYLGYCFCGWIVLGPYHEKFRSLNKVSECLFSLINGDDMFSTFAKMQQKSYLVWLFSRV
YLYSFISLFIYMILSLFIALITDTYETIKHYQQDGFPETELRKFIAECKDLPNSGKYRLE
DDPPGSLFCCCKK
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatcctgaggtggtggtaagcagctgcagttctcaccaggatgaaagtccctgc
actttctacccgagctcatcccagtccgagcagcttctcttagaagatcagatgaggcgg
aaactcaaattcttttttatgaatccttgcgagaagttctgggctcggggtaggaagcca
tggaaacttgccatacagattctgaaaatcgctatggtgactatccagctggttctgttt
ggactaagtaaccagatggtagtagctttcaaggaagagaacacgatagccttcaaacac
ctcttcctgaaaggctacatggaccgaatggacgacacctacgcggtgtacactcagaat
gatgtgtacgaccagatcatctttgcagtgacccggtacttgcaacttcgaaacatctcc
gtcggcaaccatgcttatgagaacaaggggactaagcagtcagcaatggcagtctgtcag
cacttctacaggcaaggcaccatctgccccgggaacgataccttcgacatcgatccagaa
gtcgaaacagactgtttccttatagagccagaggaagctttccacatgggaacacctgga
gaaaacaaactcaacctgaccctggacttccacagacttctgacagtggagctccaattt
aagctcaaagccatcaacctgcagacagttcgccaccaggagcttcctgactgttacgac
tttaccctgactataacattcgacaacaaggcacacagtggaagaatcaaaataagttta
gacaacgacatttctatcagagaatgcaaagattggcacgtgtctggatcaattcagaag
aacacccactacatgatgatcttcgatgcctttgttatcctgacctgcttgtcctcgctg
gtgctctgcgccaggtctgtgattcggggtcttcagcttcagcaggagtttgtcaacttt
ttccttcttcactacaagaaggaagtttcggcctctgatcagatggagttcatcaacggg
tggtacattatgatcatcgttagtgacatactgacgatcgttggatcgattctgaaaatg
gaaatccaagccaagagtcttacaagctacgatgtctgtagcatacttcttgggacttcc
accatgctcgtgtggcttggcgttatccgatacctgggtttctttgcgaagtacaatctc
cttatcctgaccctccaggcagcgctgcccaatgtcatcaggttctgttgctgtgcggct
atgatctatcttgggtattgcttttgcggatggattgtgctgggcccttaccatgagaag
ttccgctctctgaacaaggtctctgagtgcctattctcactgataaatggagacgacatg
ttttccacgttcgcgaaaatgcagcagaaaagttacctggtgtggctgttcagccgcgtc
tacctgtactcgttcatcagcctcttcatctacatgatcttgagccttttcatcgcgctc
atcacagacacgtacgaaaccattaagcactaccagcaagatggcttcccagagacggaa
cttcgaaagtttatcgctgaatgcaaagacctccccaactctggaaaatacagattggaa
gatgaccctccaggttctttattctgctgctgcaaaaagtaa

DBGET integrated database retrieval system