KEGG   Rattus norvegicus (rat): 308445Help
Entry
308445            CDS       T01003                                 

Gene name
Cyp2s1
Definition
cytochrome P450, family 2, subfamily s, polypeptide 1 (EC:1.14.14.1)
Orthology
K07420  
cytochrome P450, family 2, subfamily S, polypeptide 1 [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    308445 (Cyp2s1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    308445 (Cyp2s1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     308445 (Cyp2s1)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   308445 (Cyp2s1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q21
AA seq 499 aa AA seqDB search
MEAASTWALLLALLLLLLALTLPRTPARGQLPPGPTPLPLLGNLLQLRPGALYSGFLRLS
KKYGPVFTVHLGPWRRVVVLVGHDAIREALGGQAEEFSGRGTLATLDKTFDGHGVFFANG
ERWKQLRKFTLLALRDLGMGKREGEELIQEEVQNLVKAFQRTEGRPFNPSMLLAQATSNV
VCSLIFGIRLPYEDKEFQAVIQAASGTLLGISSPWGQAYEMFSWLLQPLPGPHTQLQHHL
GTLAAFTIQQVQRHQGRSHTSGPARDVVDAFLQKMAQEKEDPGTEFTEKNLLMTVTYLLF
AGTMTIGATIRYALLLLLKYPQVQKRVREELIQELGPSRTPSLSDRVRLPYTDAVLHEAQ
RLLALVPMGMPHTVTKTTSFRGYTLPKGTEVFPLIGSVLHDPAVFRNPEEFHPSRFLDDD
GRIRKHEAFLPYSLGKRVCLGEGLARAELWLFFTSILQAFSLDTPCPPGDLSLKPAVRGL
FNIPPDFQLQVWPTGDQSR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagccagcacctgggcgctgctgctggccctgctgctgctgctgctggctctg
acgctgcccaggaccccggcccgaggccagctacccccggggcccacgccgctgccgttg
ctggggaacctcctgcagctgcggcccggggcgctgtactcggggttcttacggctaagt
aagaagtatgggcctgtgttcacggtacacctgggcccctggcgccgcgtggtggtcctg
gttggacatgatgctattcgagaagccctgggaggtcaggctgaggaattcagcgggcgg
ggaacgttggcaactctggacaagacctttgatggtcacggagttttctttgccaatggg
gagcggtggaaacagctgaggaaattcaccctgctggctctacgggacctgggcatgggc
aagcgagagggcgaggagctgatccaggaggaggtgcagaatctggtgaaggctttccag
cggacggaaggacgtccattcaacccttccatgctgctggcccaggctacctctaatgtt
gtctgttccctcatctttggcatccgtttgccctatgaagataaagagtttcaggctgtg
atccaggcagcaagtgggaccttgttggggatcagctctccatggggccaggcctacgag
atgttctcctggctactgcagcccttgccaggcccccacacacagctccagcaccacttg
ggcaccctggctgccttcactatccagcaggtacagagacaccagggacgctcccacacc
tcaggtcctgctcgtgacgtcgtcgatgccttcctgcaaaagatggcgcaggagaaagaa
gacccaggtacagaattcaccgagaagaacttgctgatgacagtcacatacctgctgttt
gctgggactatgaccatcggagccaccatccgctatgcccttctgctcctactgaagtac
cctcaagtccaaaagcgtgttcgggaggagctgatccaggagctgggtcccagcaggact
ccaagtctcagcgatcgagttcgcctcccttacacggatgctgttttacacgaggcacag
cggctcctggccctggtacccatgggaatgccccacaccgtcacgaagaccacttccttc
agaggatatactctgcccaagggcactgaggtctttcctctgattggctccgtactgcac
gaccctgcggttttccggaacccggaagagttccatccaagccgcttcctggacgacgac
ggtcggattagaaaacacgaagccttcctgccctactccttaggtaagcgagtctgccta
ggagaaggcctggctcgggcggagctgtggctcttcttcacttccatcttgcaagccttc
tccctggacaccccgtgcccgccgggtgacttgagtctgaagccagctgtccgtggactt
ttcaacatccccccggacttccagctgcaggtctggcccactggcgatcagtccagatga

DBGET integrated database retrieval system