KEGG   Rattus norvegicus (rat): 308468Help
Entry
308468            CDS       T01003                                 

Gene name
Dyrk1b
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1b (EC:2.7.12.1)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
rno  Rattus norvegicus (rat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q21
AA seq 589 aa AA seqDB search
MAVPPGHGPFSGFPGPQEHTQVLPDVRLLPRRLPLAFRDATSAPLRKLSVDLIKTYKHIN
EVYYAKKKRRAQQAPPQDSSTKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKG
SFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHF
MFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDL
KPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLG
CILVEMHTGEPLFSGSNEVDQMSRIVEVLGIPPAPMLEQAPKARKYFERLPGGGWTLRRT
KELRKDLVLRMLEYEPAARISPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLDTCPS
SSTASSISSSGGSSGSSSDNRAYRYSNRYCGGPGPPITDCEMNSPQVLPSQPLRPWAGGD
VPHKTHQAPTSGSTLLGTGAQLPPQPRCLGRPPSPTSPPPPELMDVSLVGSPPDCSPPHP
APAPQHPAASALRTRMTGGRPPLPPPDDPATLGPRLGLHGVPQSTAASS
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcccaccaggccatggtcccttctctggctttccggggccccaggaacacaca
caggtattgcctgatgtgcggctactgccacggagactgcccctggccttccgggatgcg
acctcggccccgctgcgcaagctctcagtggacctcatcaagacctacaagcacatcaat
gaggtatactatgcgaagaagaagcggcgggcccaacaggcgccaccccaggactcgagc
accaaaaaggagaagaaggtcctgaatcacggctatgacgatgacaaccacgactacatt
gtgcgcagcggcgagcgctggctagagcgctatgaaattgactctcttattggcaaaggc
tcttttggccaggtggtgaaagcctatgatcaccagactcaggagctggtggccatcaag
atcatcaagaacaaaaaggccttcctgaaccaggcacagattgagctgaggctgctggag
ctgatgaatcagcatgatacagagatgaagtactacatagtacacctgaagcggcacttc
atgttccggaatcacctgtgcctggtgtttgagctgctgtcctacaacctgtacgacctc
ctccgcaacacacactttcgcggtgtctcactgaacctgacgaggaagctggcacagcag
ctctgcacagccctgctctttctggccacgcctgagctcagcatcatccactgcgacctc
aagcctgagaacatcctgctctgcaatcctaagcgcagcgccatcaagattgtggacttc
ggcagctcctgccagcttggccagcggatctaccagtatatccagagccgcttctaccgc
tcaccagaggtgctcctgggtacaccctatgacctggccatcgacatgtggtccctgggc
tgcatccttgtggagatgcacaccggagaacccctcttcagtggctctaatgaggtggac
cagatgagccggattgtggaggtgttgggcatccctcccgcacctatgctggaacaggca
cccaaagctcgcaagtactttgagcggctgcctgggggtggctggaccctacgaaggaca
aaggaactcaggaaggacctggtgctgcgcatgctggagtatgagcccgccgcccgcatc
agccctctgggcgctctgcagcatggcttcttccgccgcacggccgacgaggccaccaac
acgggcccggcaggcagcagtgcctccacctcgccggcgccccttgatacctgcccctcc
tctagcaccgccagctccatctccagctctggaggctccagtggctcctccagtgacaac
agggcctaccgctacagcaaccgatattgtgggggcccagggccccccatcactgactgt
gagatgaacagcccccaggtcctaccctcccagcctctgcgcccctgggcagggggtgat
gtgccccacaagacacatcaagcccctacctctggctcaacattgctggggactggggcc
cagttacccccacaaccccgttgccttggacgacccccatcacccacctcaccacccccc
ccagagctgatggatgtgagcctggtgggcagccctccagactgctctccacctcatcca
gcacctgctccccagcacccggctgcctcagccctccggactcggatgacgggaggtcga
ccacctctcccgccccctgatgaccctgccactctggggcctcgtctgggcctccatggt
gtaccccagagcacagcagccagctcatga

DBGET integrated database retrieval system