KEGG   Rattus norvegicus (rat): 308578Help
Entry
308578            CDS       T01003                                 

Gene name
Ap2a1
Definition
(RefSeq) adaptor-related protein complex 2, alpha 1 subunit
  KO
K11824  
AP-2 complex subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    308578 (Ap2a1)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    308578 (Ap2a1)
  Nervous system
   04721 Synaptic vesicle cycle
    308578 (Ap2a1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    308578 (Ap2a1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    308578 (Ap2a1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   308578 (Ap2a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q22
AA seq 977 aa AA seqDB search
MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVC
KLLFIFLLGHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL
ASRNPTFMCLALHCIANVGSREMGEAFAADIPRILVAGDSMDSVKQSAALCLLRLYKASP
DLVPMGEWTARVVHLLNDQHMGVVTAAVSLITCLCKKNPDDFKTCVSLAVSRLSRIVSSA
STDLQDYTYYFVPAPWLSVKLLRLLQCYPPPEDAAVKGRLVECLETVLNKAQEPPKSKKV
QHSNAKNAILFETISLIIHYDSEPNLLVRACNQLGQFLQHRETNLRYLALESMCTLASSE
FSHEAVKTHIDTVINALKTERDVSVRQRAADLLYAMCDRSNAKQIVSEMLRYLETADYAI
REEIVLKVAILAEKYAVDYSWYVDTILNLIRIAGDYVSEEVWYRVLQIVTNRDDVQGYAA
KTVFEALQAPACHENMVKVGGYILGEFGNLIAGDPRSSPPVQFSLLHSKFHLCSVATRAL
LLSTYIKFINLFPETKATIQGVLRAGSQLRNADVELQQRAVEYLTLSSVASTDVLATVLE
EMPPFPERESSILAKLKRKKGPGAASALDDSRRDTSSNDINGGVEPTPSNVSTPSPSADL
LGLRAAPPPAAPPAPVGGNLLVDVFSDGPTAQPSLGPTPEEAFLSELEPPAPESPMTLLA
DPAPAADPGPEDIGPPIPEADELLNKFVCKNSGVLFENQLLQIGVKSEFRQNLGRMYLFY
GNKTSVQFQSFLPTVVHPGDLQTHLAVQTKRVAAQVDGGAQVQQVLNIECLRDFLTPPLL
SVRFRYGGTAQSLTLKLPVTINKFFQPTEMAAQDFFQRWKQLSLPLQEAQKIFKANHPMD
AEVTKAKLLGFGSALLDNVDPNPENFVGAGIIQTKALQVGCLLRLEPNAQAQMYRLTLRT
SKEPVSRHLCELLAQQF
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
atgccggctgtatccaaaggcgatggcatgcgtgggcttgccgtgttcatctccgacatc
cggaactgcaagagcaaagaggctgagatcaagaggatcaacaaggaactggccaacatc
cgctccaagttcaaaggggacaaggccttggatggctacagtaaaaagaagtatgtgtgt
aagctgctcttcatcttcctgcttggccatgacattgactttggacacatggaggctgtg
aacctgctaagctccaacaagtacacagagaagcagatagggtacctgttcatctcagtc
ctggtgaactcgaactcagagctgatccggctcattaacaacgctatcaagaacgacctg
gccagtcgcaaccccaccttcatgtgcctggctttgcactgtattgccaacgtgggcagc
cgtgagatgggcgaggcctttgctgccgacattccccgaatcctggtggccggagacagc
atggatagtgtgaagcagagtgcagccctatgcctactgcgtctctacaaggcctccccc
gacttggtgcccatgggcgagtggacggcccgggtggtgcatttgctcaatgatcagcac
atgggagtggtcacagccgctgtcagtctcatcacctgcctgtgcaagaagaatccagat
gacttcaagacctgtgtctccctggctgtgtctcgcctaagccggattgtctcctcagcc
tccactgacctccaggactacacttactacttcgttcctgcaccctggctctctgtgaag
ttactgcggttgctacagtgttacccaccgccagaggatgcggctgtgaaagggcggtta
gtggagtgtcttgagactgtgctcaacaaggcccaggagcctcccaagtccaagaaggtg
cagcactccaatgccaagaacgccatcctgtttgagactattagcctcatcatccactat
gacagtgagcccaacctcctggtccgtgcctgcaaccagctgggccagttcctgcagcac
cgagagacgaacctgcgctacctggctctggagagcatgtgcaccctggccagctccgag
ttctcccacgaggctgtcaagacccacattgatactgttattaatgccctcaagactgag
cgggacgtgagtgtgaggcagcgggcagctgatctgctgtatgccatgtgtgaccggagc
aatgccaagcagattgtatcagagatgctgcggtacctagagacggctgactatgccatc
cgagaggagattgtgctgaaggtggccatcttggctgagaagtatgcagtggactacagc
tggtatgtggacaccatcctcaacctcatccgcattgcaggcgactatgtgagcgaggag
gtgtggtaccgagtgctgcagatcgtcaccaaccgtgatgatgtccagggttatgctgcc
aagacagtgtttgaggccctccaggccccagcctgtcatgagaacatggtgaaggtcggt
ggctacatccttggggagtttgggaacttgattgctggggacccacgctccagcccacct
gtgcagttctcactgctgcactccaagttccacctgtgcagtgtggccactcgtgccttg
ctgctgtccacctacatcaagttcatcaacctcttccctgagaccaaggccaccatccaa
ggtgttcttcgtgccggctcccagctgcgcaatgctgacgtggagctacagcagcgggca
gtggagtacctcaccctcagctctgtagctagcaccgatgttttggctactgtgctagaa
gaaatgcccccatttcctgagcgggagtcatccattttggctaagctgaagcgtaagaag
ggccctggggcagccagtgccctggatgacagccgcagggacaccagcagcaatgacatc
aatgggggtgtggagcccacccccagcaatgtgtcaaccccctcaccctccgcggacctc
ttggggctgcgggcagcccctccccctgctgcacccccagctcctgtaggcgggaacctc
ctggtggatgttttctctgacggccccactgcacagcccagcctgggtcccacccctgag
gaggccttcctcagcgagctggagccccctgcccctgagagccccatgactttgttggct
gacccagctccagctgctgacccaggtcctgaggacataggtcctcccattccagaagca
gatgaactgctgaataagttcgtgtgtaagaatagtggggtcttgtttgagaaccagctg
ctgcagatcggagtcaagtctgagttccggcagaacctgggccgcatgtatctcttctat
ggcaacaagacttctgtgcagttccagagcttcttgcccaccgtggtccaccctggggac
ctccagactcatctggcggtgcagaccaagcgtgtagctgcacaagtggacggtggcgca
caggtgcagcaagtactcaacattgagtgtctgcgagacttcttgacgccaccactgctg
tcggtgcgcttccggtacggtggcaccgcccagtccctcactctgaagctcccagtgacc
atcaacaaattcttccagcccacagagatggccgcccaggactttttccagcgctggaag
cagctgagcctccccctgcaggaggcacagaaaatcttcaaagccaaccaccccatggat
gctgaagtcacaaaggccaagcttctggggtttggctctgctcttctggacaatgtggat
cccaaccctgagaactttgtgggtgctggaatcatccagacgaaagccctgcaggtgggg
tgtctgcttcgactggagcccaatgcccaggcccaaatgtaccgcctaaccctgcgcacc
agcaaagagcctgtgtcccgtcacttatgtgagctgctggcccagcagttctga

DBGET integrated database retrieval system