KEGG   Rattus norvegicus (rat): 308589Help
Entry
308589            CDS       T01003                                 

Gene name
Sphk2
Definition
(RefSeq) sphingosine kinase 2
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04020  Calcium signaling pathway
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04370  VEGF signaling pathway
rno04371  Apelin signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno05152  Tuberculosis
Module
rno_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    308589 (Sphk2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    308589 (Sphk2)
   04371 Apelin signaling pathway
    308589 (Sphk2)
   04020 Calcium signaling pathway
    308589 (Sphk2)
   04072 Phospholipase D signaling pathway
    308589 (Sphk2)
   04071 Sphingolipid signaling pathway
    308589 (Sphk2)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    308589 (Sphk2)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    308589 (Sphk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     308589 (Sphk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 308589
NCBI-ProteinID: NP_001012066
RGD: 1307757
Ensembl: ENSRNOG00000021032
UniProt: Q6AYB2
Position
1q22
AA seq 616 aa AA seqDB search
MAPPPLLPVAASTPILHGEFGSYPAHGPRFALTLTTQALHIQRLRPKPEARPRDGLVPLD
EVSGCGTLQSRSPEDTAAYFCIYTYPRGRRGGRRRATRTFRADGAATYVENRAEAQRWAT
ALMCLLRGVPLSGDQEITPELLPRKPRLLLLVNPFGGRGLAWQRCMDHVVPMISEAGLSF
NLIQTERQNHARELVQGLSLSEWEGIVTVSGDGLLYEVLNGLLDRPDWEDAVRMPIGVLP
CGSGNALAGAVNHHGGFEQTVGVDLLLNCSLLLCRGGSHPLDLLSVTLASGSRCFSFLSV
AWGFLSDVDIHSERFRALGSARFTLGAVLGLATLHTYRGRLSYLPATTEPALPIPGHGLP
RAKSELALAPAPAPAATHSPLHRSVSDLPLPLPQPALASPGSPEPLPDLSLNGGGPELTG
DWGGAGDAPLSPDPLLPSSPNAFKTAQLSPIAEGPSEMPASGLLPPIHNAPEASTWGPAD
HLLPPLGSPLPQDWVTIEGEFVLMLAILPSHLCADLMAAPHARFDDGVVHLCWVRSGISR
AALLRILLAMEHGNHFSLGCPHLGYAAARAFRLEPLTPRGVLTVDGELVEYGPIQAQVHP
SLATLLTGPAGQKPRA
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggccccaccaccactactgccagtggctgccagcactccgatcctgcacggcgagttt
ggttcctacccagcccatggccccaggtttgccctcaccctcacgacacaagccctacac
atacagcgactgcgcccaaagccagaagcccggccccgagatggtctagtccctctggac
gaggtctcaggctgtggcactctgcagagccgtagccccgaagacactgcagcctacttc
tgcatctacacctacccacgtggccggcgtgggggccggcgcagagctactcgtaccttc
cgggccgacggggccgccacttatgtggagaatcgtgcagaggcccagcgttgggcaact
gctctcatgtgtctcctccgaggagtgcctctgtctggggaccaggaaatcacccctgaa
ttgctgccccggaagcccaggctgctcctattggtcaatccttttggggggcggggcctg
gcctggcagcgctgtatggaccacgtggtgcccatgatctctgaagctgggctgtccttc
aacctcatacagacagaacgacaaaaccatgcacgtgagctggtgcaggggttgagcctg
agtgagtgggaaggcattgtcactgtgtccggagatgggctgctttatgaggtgctgaat
gggctcctcgaccgcccagattgggaagacgctgtgcggatgcccattggtgtcctcccc
tgtggttcgggcaatgcactagctggggcagttaaccatcatggcgggtttgagcaaact
gttggtgttgacctgttgctcaactgctcgcttcttctctgccggggtggcagccatcct
ctggacctgctctctgtgacgctagcctcaggatcccgctgtttttccttcctgtcagtt
gcctggggattcttgtcagatgtggacattcacagcgagcgcttcagagccctgggcagt
gctcgattcacactgggtgcagtgctaggcctggccacattgcatacctaccgtggacgt
ctctcctacctccctgctaccacagaaccagccttgcccatcccaggccatggtctgcca
agagccaagtcagaactagccttggccccagccccagccccagccgccacccactcacct
cttcatcgatctgtgtctgacctgcccctgcctcttccccagcctgccctggcctcccct
ggctcccctgagcccctgcctgacctgtccctcaatggtggtggtccagagctgactgga
gactgggggggagctggggatgcacctttgtccccagacccattgctgccttcatccccc
aacgctttcaaaacagctcagctttcacccatcgccgaagggccctcagaaatgccagca
tcagggctgctgcctcccatccacaatgctccagaagcctctacctggggcccagcggac
cacctgctccctcccctgggctctccactgccccaagactgggtgacaatagagggggag
tttgtactcatgttggccatcttgccaagccacctctgcgcagacctgatggcagcccca
cacgcgcgttttgacgatggtgtggtgcacctgtgctgggtgcggagcggcatctcacgg
gccgcacttctacgaattttgctggccatggaacatggaaaccacttcagcctgggctgc
ccacatctgggctatgctgcagcacgtgccttccgccttgagccactcacgcctcgtggg
gtgctcactgtagatggggaattagtagagtatgggccaatacaggcacaggtgcatcca
agtctcgccacactgctcactgggcctgcaggtcaaaagcctcgagcctga

DBGET integrated database retrieval system