KEGG   Rattus norvegicus (rat): 308589Help
Entry
308589            CDS       T01003                                 

Gene name
Sphk2
Definition
sphingosine kinase 2 (EC:2.7.1.91)
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
rno  Rattus norvegicus (rat)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    308589 (Sphk2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    308589 (Sphk2)
   04020 Calcium signaling pathway
    308589 (Sphk2)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    308589 (Sphk2)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    308589 (Sphk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     308589 (Sphk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q22
AA seq 616 aa AA seqDB search
MAPPPLLPVAASTPILHGEFGSYPAHGPRFALTLTTQALHIQRLRPKPEARPRDGLVPLD
EVSGCGTLQSRSPEDTAAYFCIYTYPRGRRGGRRRATRTFRADGAATYVENRAEAQRWAT
ALMCLLRGVPLSGDQEITPELLPRKPRLLLLVNPFGGRGLAWQRCMDHVVPMISEAGLSF
NLIQTERQNHARELVQGLSLSEWEGIVTVSGDGLLYEVLNGLLDRPDWEDAVRMPIGVLP
CGSGNALAGAVNHHGGFEQTVGVDLLLNCSLLLCRGGSHPLDLLSVTLASGSRCFSFLSV
AWGFLSDVDIHSERFRALGSARFTLGAVLGLATLHTYRGRLSYLPATTEPALPIPGHGLP
RAKSELALAPAPAPAATHSPLHRSVSDLPLPLPQPALASPGSPEPLPDLSLNGGGPELTG
DWGGAGDAPLSPDPLLPSSPNAFKTAQLSPIAEGPSEMPASGLLPPIHNAPEASTWGPAD
HLLPPLGSPLPQDWVTIEGEFVLMLAILPSHLCADLMAAPHARFDDGVVHLCWVRSGISR
AALLRILLAMEHGNHFSLGCPHLGYAAARAFRLEPLTPRGVLTVDGELVEYGPIQAQVHP
SLATLLTGPAGQKPRA
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggccccaccaccactactgccagtggctgccagcactccgatcctgcacggcgagttt
ggttcctacccagcccatggccccaggtttgccctcaccctcacgacacaagccctacac
atacagcgactgcgcccaaagccagaagcccggccccgagatggtctagtccctctggac
gaggtctcaggctgtggcactctgcagagccgtagccccgaagacactgcagcctacttc
tgcatctacacctacccacgtggccggcgtgggggccggcgcagagctactcgtaccttc
cgggccgacggggccgccacttatgtggagaatcgtgcagaggcccagcgttgggcaact
gctctcatgtgtctcctccgaggagtgcctctgtctggggaccaggaaatcacccctgaa
ttgctgccccggaagcccaggctgctcctattggtcaatccttttggggggcggggcctg
gcctggcagcgctgtatggaccacgtggtgcccatgatctctgaagctgggctgtccttc
aacctcatacagacagaacgacaaaaccatgcacgtgagctggtgcaggggttgagcctg
agtgagtgggaaggcattgtcactgtgtccggagatgggctgctttatgaggtgctgaat
gggctcctcgaccgcccagattgggaagacgctgtgcggatgcccattggtgtcctcccc
tgtggttcgggcaatgcactagctggggcagttaaccatcatggcgggtttgagcaaact
gttggtgttgacctgttgctcaactgctcgcttcttctctgccggggtggcagccatcct
ctggacctgctctctgtgacgctagcctcaggatcccgctgtttttccttcctgtcagtt
gcctggggattcttgtcagatgtggacattcacagcgagcgcttcagagccctgggcagt
gctcgattcacactgggtgcagtgctaggcctggccacattgcatacctaccgtggacgt
ctctcctacctccctgctaccacagaaccagccttgcccatcccaggccatggtctgcca
agagccaagtcagaactagccttggccccagccccagccccagccgccacccactcacct
cttcatcgatctgtgtctgacctgcccctgcctcttccccagcctgccctggcctcccct
ggctcccctgagcccctgcctgacctgtccctcaatggtggtggtccagagctgactgga
gactgggggggagctggggatgcacctttgtccccagacccattgctgccttcatccccc
aacgctttcaaaacagctcagctttcacccatcgccgaagggccctcagaaatgccagca
tcagggctgctgcctcccatccacaatgctccagaagcctctacctggggcccagcggac
cacctgctccctcccctgggctctccactgccccaagactgggtgacaatagagggggag
tttgtactcatgttggccatcttgccaagccacctctgcgcagacctgatggcagcccca
cacgcgcgttttgacgatggtgtggtgcacctgtgctgggtgcggagcggcatctcacgg
gccgcacttctacgaattttgctggccatggaacatggaaaccacttcagcctgggctgc
ccacatctgggctatgctgcagcacgtgccttccgccttgagccactcacgcctcgtggg
gtgctcactgtagatggggaattagtagagtatgggccaatacaggcacaggtgcatcca
agtctcgccacactgctcactgggcctgcaggtcaaaagcctcgagcctga

DBGET integrated database retrieval system