KEGG   Rattus norvegicus (rat): 308800Help
Entry
308800            CDS       T01003                                 

Gene name
Tyr, C
Definition
(RefSeq) tyrosinase
  KO
K00505  tyrosinase [EC:1.14.18.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00350  Tyrosine metabolism
rno01100  Metabolic pathways
rno04916  Melanogenesis
Module
rno_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    308800 (Tyr)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    308800 (Tyr)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     308800 (Tyr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tyrosinase
Motif
Other DBs
NCBI-GeneID: 308800
NCBI-ProteinID: NP_001101005
RGD: 1589755
Ensembl: ENSRNOG00000016421
UniProt: D4A9G4
Position
1q32
AA seq 530 aa AA seqDB search
MFLAVLYYLLWSFQTSAGHFPRDCASSKNLMAKECCPPWMGDGSPCGHLSGRGSCQDILL
SNAPSGPQFPFKGVDDRESWPSVFYNRTCQCSGNFMGFNCGNCKFGFGGPNCTEKRLLIR
RNIFDLSASEKNKFFSYLTLAKHTISSVYVIPTGTYGQMNNGSTPMFKDINIYDLFVWMH
YYVSRDTLLGGSEIWRDIDFAHEAPGFLPWHRLFLLLWEQEMQELTGDENFTIPYWDWRD
AENCDICTDEYLGGRHPENPNLLSPASFFSSWEIICSRSEEYNSHQVLCDGTPEGPLLRN
PGNHDKAKTPRLPSSADVEFCLSLTQYESGSMDRTANFSFRNTLEGFASPLTGIADSSQS
SMHNALHIYMNGTMSQVQGSANDPIFLLHHAFVDSIFEQWLRRHRPLLEVYPEANAPIGH
NRESYMVPFIPLYRNGDFFISSKDLGYDYSYLQESDPGFYRNYIEPYLEQASRIWPWLLG
AALVGAVVATALAGLSSRLCHQKKKQPQEERQPLLMDKDDYHSLLYQSHL
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttcttggctgttttgtattaccttctgtggagttttcagacctctgctggccatttt
cctcgagactgtgcctcctctaagaacttgatggcaaaagaatgctgcccaccatggatg
ggtgatgggagtccctgcggccacctttcagggagaggttcctgccaggacatccttttg
tccaatgcaccatctggacctcagttccccttcaaaggggtggatgaccgtgagtcctgg
ccctctgtgttttataataggacctgccagtgctctggaaacttcatgggtttcaattgc
ggaaactgtaagtttggatttgggggcccaaattgtacagagaagcgactcttaattaga
cgaaacatttttgatttgagtgcctcagaaaagaataagttcttttcttacctcactttg
gcaaaacatactatcagctcagtctatgtcatccccacaggcacctatggccaaatgaac
aatgggtcgacacccatgtttaaggacatcaacatctatgacctctttgtatggatgcat
tactatgtgtcaagggacacactgcttgggggctctgaaatctggagggacattgatttt
gctcatgaagcaccaggatttttgccttggcacagactgttcttgctattatgggaacaa
gaaatgcaggaactaactggggatgagaatttcaccattccatattgggactggagagat
gcggaaaactgtgacatttgcacagatgagtacctgggaggtcgtcaccctgaaaatcct
aacttactcagcccagcgtccttcttctcctcctgggagatcatttgcagcagatcagaa
gagtataatagccatcaggttttatgtgatggaacacctgagggaccactattacgtaat
cctggaaaccatgacaaagccaaaacccccaggctcccatcttcagcagacgtggaattt
tgtttgagtttgacccagtatgaatctggatcaatggatagaactgccaatttcagcttt
agaaacacactggaaggatttgccagtccactcacagggatagcagattcttctcaaagt
agcatgcacaacgctctgcatatctatatgaatggaacaatgtcgcaagtacagggatcg
gccaatgatcccatttttcttcttcatcatgcttttgtggacagtatttttgaacaatgg
ctccgaagacaccgccctcttttggaagtttacccagaagccaatgcacctattggccat
aacagagaatcctacatggttcctttcattccactctatagaaatggtgatttcttcatt
tcatccaaggatctgggatatgactacagttacctacaagaatcagatccaggcttttac
cgaaactatattgaaccctacttggaacaagctagtcgtatctggccatggcttcttgga
gcagcactggtgggagctgttgttgctacagctctagctgggctcagcagtaggctatgc
catcagaagaaaaagcaaccccaggaggaaaggcagcccctcctcatggacaaagatgac
taccacagcttgctgtaccagagccatctatga

DBGET integrated database retrieval system