KEGG   Rattus norvegicus (rat): 308834Help
Entry
308834            CDS       T01003                                 

Gene name
Usp35, RGD1565984
Definition
ubiquitin specific peptidase 35
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     308834 (Usp35)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   308834 (Usp35)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q32
AA seq 1007 aa AA seqDB search
MDKILEAVVTSSYPASVKQGLVRRVLEAARQPLEREQCLALLALGARLYVGGTDELPRRV
GCQLLHVAGRHHPDVFAEFFSARRVLRLLQGGAGPPGARALACVQLGLQLLPDGPAADEV
FALLRREVLRTVCERPGPAACAQVARLLARHPRCVPDGAHRLLFCQQLVRCLGRFRCPAE
GEEGAVEFLEQAQQVSGLLAQLWRAQPAAILPCLKELFAVISCTEEEPPSSALASVVQHL
PLELMDGVVRNLSNDDSVTDSQMLTAISRMIDWVSWPLGKNIDKWIIALLKGLAAVKKFS
ILIEVSLAKIEKVFSKLLYPIVRGAALCVLKYMLLTFQHSHEAFHLLLPHIPPMVAALVK
EDSNSGTSCLEQLAELVHCMVFRFPGFPDLYEPVMEAIKDLHIPNEDRIKQLLGQDAWTS
QKSELAGFYPRLMAKSDTGKIGLINLGNTCYVNSVLQALFMASDFRHCVLRLTENNSQPL
MTKLQWLFAFLEHSQRPAISPENFLSASWTPWFSPGTQQDCSEYLKYLLDRLHEEEKTGT
RICQKLKQSSLPSPQEELPSSNATSVERMFGGKIVTRICCLHCLNVSSREEAFTDLSLAF
PPPERSRHRRLGSVMLPTEDVRAQELTLAPRAPGAQRQRKHCITGDAPRTGLDIEGVDTV
GNGGQSGQEKVEREQAGKEKEVAEDREEEGPREEEKEEGEEKDKEKKEDEKEKEAEDGKE
KEGDSLGPGTRKDAATPPREQACGPEGSRSVLDLVNYFLSPERLTAENRYYCESCASLQD
AEKVVELSQGPCYLILTLLRFSFDLRTMRRRKILDDVTIPLLLRLPLAGGQGQAYDLCSV
VVHSGVSSESGHYYCYAREGAARPAPVLGSTERPEPENQWYLFNDTRVSFSSFESVSNVT
SFFPKDTAYVLFYRQRPQEAPEAEPGSPRVRAEPTLHKDLMEAISKDNVLYLQEQEKEAR
SRAAYISTLPAPPHWSRGFDEDKDEDEGSAGGCNPAGGNGDFHRLVF
NT seq 3024 nt NT seq  +upstreamnt  +downstreamnt
atggacaagatcctggaggccgtggtgacttcgtcctaccctgcgagtgtgaagcaaggg
ctggtgcggcgcgtgctggaggctgcacggcagcccttggagcgggagcagtgcctggcg
ctgctggccctgggcgcgcgcctctacgtgggtggcacggacgagctgccgcgccgcgtg
ggctgccagctgctgcacgtggcgggccgccaccaccccgacgtcttcgccgagttcttc
agcgcgcgccgcgttttgcgcctgctgcagggtggtgcggggcccccgggtgcgcgcgcg
ctggcctgcgtgcagctaggactgcagctgctgcccgacgggcccgcggccgacgaggtg
ttcgcgctgctgcggcgcgaggtgctgcgcaccgtgtgcgagcgcccgggccccgccgcc
tgcgcgcaggttgcccggctgctggcgcgccacccgcgctgcgtacccgacggcgcgcac
cgcctgctcttctgccagcagctggtgcgctgcctaggccgcttccgctgcccagccgag
ggcgaagagggcgcggtggagttcctggagcaggcccagcaggtgagcgggctcctggcg
cagctctggcgcgcgcagcccgcagccatcctgccctgcctcaaggagctgttcgcggtc
atctcctgcacagaggaggagccaccgtccagcgccttggccagtgtggtccagcacctc
ccgttggaactcatggatggtgtggtccggaaccttagcaatgatgacagcgtgacagac
tcccagatgctgactgccattagcaggatgatcgactgggtgtcctggcccctggggaag
aacattgacaagtggatcattgccctgctgaagggcctggctgccgttaagaagttcagc
atcttgatcgaggtttcgctcgccaaaattgagaaggtcttctctaagctgctgtacccc
attgtgcggggagctgccctctgtgtcctcaagtacatgctgctgaccttccagcattcc
cacgaggctttccacctgcttctccctcacattcctcccatggtggccgctctggttaag
gaggattcgaactctgggaccagctgcctggagcagctggcagagctggtgcactgcatg
gtgtttcggttcccaggcttcccagacctgtatgaacctgtcatggaagccatcaaggac
ctccacattcccaatgaggaccgaatcaagcagctgctggggcaggatgcctggacctca
cagaagagtgaactggctggcttctatccccggctcatggccaagtcagacacgggcaag
attggtttgatcaacttgggcaacacatgctatgtgaacagtgtccttcaggccttattc
atggcctctgactttcgacactgtgtgctgcgcttgactgagaacaactcccagcccttg
atgaccaagctgcaatggctctttgccttcctggagcacagtcagaggcctgccatctct
cctgagaacttcctctctgcatcctggacaccctggttcagccctggcacccagcaggac
tgttcagaatatctgaagtacctgctggatcggcttcatgaagaagagaaaactgggaca
aggatctgccagaagctcaagcagtccagcttgccatccccacaggaagagctccccagc
tccaatgcaacatctgtggagagaatgttcggaggcaagattgtgacgcggatatgctgt
ctccactgcctcaatgtttcctcaagggaggaggccttcacagacctctctttggccttc
cctcctcctgagagaagtcgccaccgccgccttggctctgtgatgctccccacggaggat
gttcgagcccaggagttgacgctggctcccagagccccaggggcgcagaggcagaggaag
cactgcatcacaggggacgctcctcgcactgggctggacattgaaggtgtggacaccgta
ggcaatggcggacagagtgggcaggagaaggtagagagggaacaggctgggaaggagaag
gaggtggcagaggacagggaagaggaaggaccaagggaagaggagaaagaagaaggggaa
gagaaagacaaagagaagaaggaagatgagaaggaaaaggaagccgaggacggcaaggag
aaggaaggggacagcttgggaccagggacccgcaaggatgctgccactccacccagggag
caggcatgtggccctgagggttcccgctctgtactggacttggtcaactacttcctgtct
cctgagaggctgacagctgagaaccgctactactgtgagtcctgtgcctccctgcaggat
gcggagaaggtggtggagctgagccagggtccatgctacctcatccttacactgctgcgc
ttctcctttgacctgcgtaccatgcggcggcgcaagatcctggacgatgtcaccatcccc
cttctgctgcgcctgccactggctgggggtcagggccaggcctatgacctctgtagtgtg
gtcgtacactctggagtgtcctcagagagtggccactattactgctatgctcgtgagggt
gctgctcggccagctcctgtcctgggatccacagagaggcctgagcccgagaaccagtgg
tacctgtttaatgatacccgggtgtcgttctcatcctttgagtctgtcagcaatgtcacc
tcctttttccctaaggacactgcctatgtgctcttctaccgccagaggccccaggaggcc
cctgaggctgagcctggttctcctagagtccgagcagagcctaccctccacaaggacctg
atggaggccatttccaaagacaatgtcctctacctgcaggaacaggagaaggaggcacgg
agcagggcagcttacatctctacactccctgcccctccacactggagtagaggcttcgat
gaagataaagatgaggatgaaggctcggcagggggttgcaaccctgcagggggcaatggt
gacttccacagactggtcttctaa

DBGET integrated database retrieval system