KEGG   Rattus norvegicus (rat): 308873Help
Entry
308873            CDS       T01003                                 

Gene name
Art1
Definition
ADP-ribosyltransferase 1 (EC:2.4.2.31)
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     308873 (Art1)
Cellular antigens [BR:rno04090]
 Proteins
  308873 (Art1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q32
AA seq 321 aa AA seqDB search
MKIPAMMSLLLVSVGLRDGVQVQSYSISQLDIFSQETPLDMAPASFDDQYAGCLADMTAA
LPDLNHSEFQANKVYADGWALANIQWQDRRAWGSLWGSLPPPPPGFRDEHGVALLAYTAN
SPLHKEFNAAVREAGRSRAHYLHHFSFKTLHFLLTEALQLLRNHRSPGCRQVYRGVHGLR
FRPAGPGATVRLGGFASASLKNVAAQQFGEDTFFGIWTCLGAPIRGYSFFPEEEEVLIPP
FETFQVINTSRPAQGPARIYLRALGKRSTYNCEYIKEKKCRSGPCWLNSSAPGSLSASWS
LLLLVLFLMLRALPENPGLRC
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccctgctatgatgtctctcctactggtgtctgtgggtctcagggacggagtt
caggttcaaagttactccatctcacaactagacatcttttctcaagaaacacccctggac
atggccccagcgtcctttgatgaccagtatgctggctgcctggccgacatgacagcggca
ctgccagatctcaatcactcagagttccaggccaacaaagtatacgcggatggctgggct
ctggctaacatccagtggcaggaccgcagggcctgggggtccctgtggggctccttgccc
ccaccaccgccgggcttccgggatgagcacggcgtggcgctgctggcctacaccgccaac
agccccctgcacaaggagttcaacgcggcagtgcgcgaggcgggccgctcccgggcccat
taccttcaccacttctcgttcaagaccctccactttctgctcaccgaggccctgcaactg
ctccggaaccaccgatctcccgggtgccggcaggtgtacaggggggtgcatggcctgcgt
ttccggccagcgggacctggcgccaccgttaggctagggggctttgcttccgcgtccctc
aagaacgttgccgcccaacaatttggcgaggacaccttcttcggtatctggacctgcctc
ggtgcccccatcaggggctactcctttttccctgaagaggaagaggtgctgatcccccct
ttcgaaactttccaggtgatcaataccagccgacccgcccagggtcctgcacgcatctac
ctccgtgctctgggcaaacgcagcacatacaactgcgaatacataaaagaaaagaagtgc
aggtctgggccctgctggctgaatagctcagccccaggctccctctcggcctcatggtct
cttctgctgctggtcttgttccttatgctgagagcccttccagagaacccaggtctccga
tgttga

DBGET integrated database retrieval system