KEGG   Rattus norvegicus (rat): 308896Help
Entry
308896            CDS       T01003                                 

Gene name
Usp47
Definition
ubiquitin specific peptidase 47
Orthology
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     308896 (Usp47)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   308896 (Usp47)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q33
AA seq 1355 aa AA seqDB search
MVPGEENQLVPKEIENAAEEPRVLCIIQDTTNSKTVNERITVNLPASTPVRKLFEDVANK
VGYINGTFDLTWGNGINTADLAPLDHTSDKSLLDANFEPGKKNFLHLTDKDGEQPQMLLD
DSSHVDDSVHDRFIGPLPREGSVASTSDYVSQSYSYSSILNKSETGYVGLVNQAMTCYLN
SLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSF
GWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINELYQGKLKDYVRCLECGYEGWR
IDTYLDIPLVIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFL
HFPYLLTLQLKRFDFDYTTMHRIKLNDRMSFPEELDMSTFIDIEDEKSPQTESCTDSGAE
NEGSCHSDQMSNDFSTDDAVDEGICLESSTGSEKISKPGLEKNSLMYELFSVMVHSGSAA
GGHYYACIKSFSDDQWYSFNDQHVSRITQEDIKKTHGGSSGSRGYYSSAFASSTNAYMLI
YRLKDPTRNAKFLEVDEYPEHIKNLVQKERELEEQEKRQREIERNTCKIKLFCLHPVKQV
MMENKLEVHKDKTLKEAVEMAYKMMDLEDVIPLDCCRLVKYDEFHDYLERSYEGEEDTPM
GLLLGGVKSTYMFDLLLETRKPDQIFQSYKPGEVMVKVHVVDLKAETVAAPVTVRAYLNQ
TVLEFKQLISKATHLPAEPMRIVLERCYNDLRLLSMPSKTLKAEGFFRSNKVFVESSETV
DHQAAFTDSHLWKLLDRHANTIRLFVLLPEQSPGSYSKRTAYQKAGGDSGNVDDDCERAK
GPAGSLKSVDAILEESTEKLKSLSLQQQQDGDNGDSSKSTETSDFENIESPLNERGSSTS
VDNRELEQHIQTSDPENFQSEERSDSDVNNDRSTSSVDSDILSSSHSSDTLCNADSAQIP
LANGLDSHSITSSRRTKANEGKKETWDTAEEDSGTDSEYDESGKSRGEMQYMYFKADPYT
ADEGSGEGHKWLMVHVDKRITLAAFKQHLEPFVGVLSSHFKVFRVYTSNQEFETVRLNET
LSSFSDDNKITIRLGRALKKGEYRVKVCQLLVNEQEPCKFLLDAVFAKGMTVRQSKEELI
PQLREQCGLDLSIDRFRLRKKTWKNPGTVFLDYHIYEEDINISSNWEVFLEVLDGVEKMK
SMSQLAILTRRWRPSEMKLDPFQELVLESNSVDELREKLSEISGIPLEDIEFAKGRGTFP
CDISVLDIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDRTEEVMELTDEQRNELMKKES
SRLQKTGHRVTYSPRKEKALKIYLDGAPNKDVAQD
NT seq 4068 nt NT seq  +upstreamnt  +downstreamnt
atggtgcccggcgaggagaaccaactggtcccgaaggagatagaaaatgctgctgaagaa
cctagagtcttatgtataatacaggacactactaactcaaagacagtgaatgaacggatc
acagtgaatttaccagcatctaccccagtcagaaagctctttgaagatgtggccaacaaa
gtaggctacataaacggaacctttgatttgacatggggaaatggaatcaatactgctgat
ttggcaccactggatcacaccagtgacaagtctcttcttgatgctaattttgagccagga
aagaagaactttctgcatttgacagataaagatggagaacagcctcagatgctattggat
gactccagtcacgtggacgacagcgtgcatgacaggtttataggtccacttccaagagaa
gggtctgtggcttctaccagtgattatgtcagccagagctactcctattcatcaattttg
aacaagtcagaaactggttatgtgggattagtaaaccaggcgatgacgtgctatttgaat
agccttttgcaaacactttttatgactcctgaatttaggaatgccttatataagtgggag
tttgaagagtctgaagaagatcctgtaacgagcatcccataccagcttcagaggcttttt
gttctgttacaaaccagcaaaaagagagcaattgagaccacagatgtcacaaggagcttt
ggatgggatagcagtgaggcttggcaacagcatgatgtacaagaactgtgccgtgttatg
tttgatgctttggaacagaaatggaagcaaacagaacaggctgatcttataaatgagctg
taccaaggcaaactgaaagactatgtgaggtgtctggaatgcggttatgaaggctggaga
attgacacgtaccttgatattccactggtcatccgaccttatgggtctagccaagcattt
gccagtgtggaagaagcattgcatgcatttattcaaccagagatcttggatggcccaaat
caatacttctgtgaacgttgtaagaagaagtgcgatgctcgtaagggccttcggtttttg
cactttccctatctgctgactttacagttgaaaaggtttgattttgattatacaaccatg
catagaattaaactgaatgatcgaatgtcatttccagaggagctggatatgagcacattt
attgatattgaagatgagaaatctcctcagactgaaagttgcactgatagtggagcggaa
aatgaaggcagttgccacagcgaccagatgagcaatgatttctccacggatgatgctgtt
gatgaagggatatgcctggagagcagtactgggagtgagaagatttcaaaacctggcctg
gaaaagaactccctgatgtatgagctcttctcggtgatggtacattcagggagtgctgct
gggggacactattatgcttgcataaagtctttcagcgacgatcagtggtacagtttcaat
gaccaacatgtgagcaggataacacaagaagacattaagaagacacacggtgggtcttca
ggaagcagaggctactactccagtgcttttgcaagctcaacaaatgcatatatgctgata
tacagactgaaggatccaacaagaaatgcaaaatttctggaagtggatgagtacccagaa
cacattaagaacctggtgcagaaggagagagaattggaagaacaggaaaagaggcaacga
gaaattgaacgaaacacatgcaagataaaattattctgtttacatcctgtgaaacaagta
atgatggaaaacaagttggaggttcataaggacaagacattaaaggaagcagtagaaatg
gcttataagatgatggatttagaagacgtgattcccttggattgctgtcgcctggtaaaa
tatgatgagtttcatgattacctggaacgatcctatgagggagaagaagatacgccaatg
gggctgcttctaggaggagtcaagtcaacgtacatgtttgatctgctgttggagacaaga
aagcctgatcaaatttttcagtcttataaacctggagaagtgatggtgaaagttcatgtt
gtcgatctgaaggcagagactgtcgctgctcctgtaacagtgcgtgcttatttaaatcag
acagttttggagttcaaacagctgatctcaaaggccacacacttacctgcagaacccatg
aggatcgtgctggagcgctgctacaacgacctgcgcctgctcagcatgcccagcaagacc
ctgaaggctgagggcttctttagaagtaacaaggtgtttgttgaaagctctgagacagta
gatcaccaggcagccttcacagactcccacttgtggaaactcctggatcgacatgcaaat
acaatccggttatttgttttgctgcctgaacaatctccagggtcttattcgaaaaggaca
gcataccagaaagctggaggggattctggtaatgtggacgatgactgtgaaagagccaag
ggacctgcaggaagtttaaagtctgtggatgccattctagaagagagcactgaaaaactc
aaaagcctgtcactgcagcagcagcaggatggggacaacggagacagcagcaaaagcact
gagacaagtgactttgagaatattgaatcccctctcaatgagaggggctcttccacctct
gtggataatcgagaacttgaacaacacattcagacttctgacccagaaaactttcagtct
gaagaacgctcagactcagatgtgaataatgaccggagtacaagttcggtagacagcgat
attcttagctctagtcacagcagcgacactttgtgcaatgcagacagcgctcagattcct
ttggccaatggactcgattctcacagtatcacaagtagtagaagaactaaggcaaacgaa
gggaaaaaggagacatgggacacagctgaagaagactctgggactgacagtgaatatgat
gagagtggcaagagcaggggggagatgcagtacatgtacttcaaagctgacccctacact
gcggacgaaggctctggggaaggacacaaatggttgatggtgcatgttgataagagaatc
accctggcagctttcaaacagcatttagagccttttgttggagtcctctcctctcacttc
aaggtttttcgagtgtacaccagcaatcaagagtttgagaccgtccggttgaatgagacc
ctttcatcattttcagatgacaataagatcacaatccgactggggagagcactgaagaag
ggagagtacagagttaaagtgtgccagctcttagtcaatgagcaagagccatgcaagttt
ctgctagacgccgtatttgctaaaggcatgactgtgcggcaatcgaaagaggagctgatt
cctcaactcagggagcagtgtggcttagacctcagcatcgacaggtttcgtctaaggaag
aaaacatggaagaatcctggcactgtttttttggattatcatatttatgaagaagatatt
aatatttctagcaactgggaagttttcctggaagttcttgatggtgtggagaagatgaag
tccatgtcacagcttgccattttaaccagacggtggaggccttcggagatgaagttggat
cccttccaggagcttgtgttggagagcaatagtgttgatgagcttcgagagaagctgagt
gaaatcagtgggattcctttggaagacattgaatttgccaagggtaggggaaccttcccc
tgtgatatttctgtccttgatattcatcaagatttggactggaaccctaaagtctctacc
ttgaatgtgtggcctctttatatctgtgatgatggtgccgtcatattttatagggataga
acagaagaagtaatggaattgacagatgagcaaaggaatgaactgatgaaaaaggaaagc
agccgactgcagaagacgggacatcgtgtgacatactcccctcgcaaagagaaagcactc
aagatctacctggatggggcgccaaataaagacgtagctcaagactga

DBGET integrated database retrieval system