KEGG   Rattus norvegicus (rat): 308965Help
Entry
308965            CDS       T01003                                 

Gene name
Chp2, chp-2
Definition
(RefSeq) calcineurin-like EF hand protein 2
  KO
K17611  calcineurin B homologous protein 2
Organism
rno  Rattus norvegicus (rat)
Brite
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     308965 (Chp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_6 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_8 SPARC_Ca_bdg RST DIMCO_N EF-hand_9
Motif
Other DBs
NCBI-GeneID: 308965
NCBI-ProteinID: NP_877402
RGD: 727796
Ensembl: ENSRNOG00000019112
UniProt: Q810D1
Position
1q36
AA seq 196 aa AA seqDB search
MGSRSSHVALIPDVDQIRRETGFSQASLLRLYHRFQALDREEKGFLSRLDLQQIGALAVN
PLGDRIIDSFFPNGSQRVYFAGFARVLAYFRPIDEDDATLRDPKQPEPLNSRMNKLRFAF
QLYDLDRDGKISRNEMLQVLRLMVGVQVTDEQLESITDRTVQEADEDGDGAVSFLEFAKS
LEKMNIEQKMSIRILK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgggctcacggagctctcatgtcgcgctcattcctgatgtggaccaaattcgcagagag
acgggcttctcccaagctagcctgctccgtctctaccacaggttccaagccctagacagg
gaggaaaagggcttcctgagccgcctagacctccagcagattggagccctggctgtgaac
cccctgggtgaccgcattatagacagcttcttccccaatgggagtcagagagtgtatttc
gcaggctttgccagagtcctggcttattttcgacctatagatgaagacgatgccacactc
cgagaccccaagcaacctgaacccctaaacagcagaatgaataaactgcgctttgcattt
cagctctatgatctggatcgggatgggaagatctccaggaatgaaatgctacaggttctc
cgcctcatggttggggtccaggtgacagacgagcagttggagagcatcacagaccgcaca
gtgcaggaagccgatgaagatggggatggggccgtgtccttcctggagttcgccaagtcc
ttagagaagatgaacatcgagcagaagatgagcatccggatcctgaagtga

DBGET integrated database retrieval system