KEGG   Rattus norvegicus (rat): 308965Help
Entry
308965            CDS       T01003                                 

Gene name
Chp2, chp-2
Definition
calcineurin-like EF hand protein 2
Orthology
K17611  
calcineurin B homologous protein 2
Organism
rno  Rattus norvegicus (rat)
Brite
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     308965 (Chp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q36
AA seq 196 aa AA seqDB search
MGSRSSHVALIPDVDQIRRETGFSQASLLRLYHRFQALDREEKGFLSRLDLQQIGALAVN
PLGDRIIDSFFPNGSQRVYFAGFARVLAYFRPIDEDDATLRDPKQPEPLNSRMNKLRFAF
QLYDLDRDGKISRNEMLQVLRLMVGVQVTDEQLESITDRTVQEADEDGDGAVSFLEFAKS
LEKMNIEQKMSIRILK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgggctcacggagctctcatgtcgcgctcattcctgatgtggaccaaattcgcagagag
acgggcttctcccaagctagcctgctccgtctctaccacaggttccaagccctagacagg
gaggaaaagggcttcctgagccgcctagacctccagcagattggagccctggctgtgaac
cccctgggtgaccgcattatagacagcttcttccccaatgggagtcagagagtgtatttc
gcaggctttgccagagtcctggcttattttcgacctatagatgaagacgatgccacactc
cgagaccccaagcaacctgaacccctaaacagcagaatgaataaactgcgctttgcattt
cagctctatgatctggatcgggatgggaagatctccaggaatgaaatgctacaggttctc
cgcctcatggttggggtccaggtgacagacgagcagttggagagcatcacagaccgcaca
gtgcaggaagccgatgaagatggggatggggccgtgtccttcctggagttcgccaagtcc
ttagagaagatgaacatcgagcagaagatgagcatccggatcctgaagtga

DBGET integrated database retrieval system