KEGG   Rattus norvegicus (rat): 309070Help
Entry
309070            CDS       T01003                                 

Gene name
Uros
Definition
uroporphyrinogen III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rno  Rattus norvegicus (rat)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    309070 (Uros)
Enzymes [BR:rno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     309070 (Uros)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q41
AA seq 265 aa AA seqDB search
MKVLLLKDAKDDDSGQDPYIQELRLCGLEATLIPVLSFEFMSLPSLSEKLSHPEGFGGLI
FTSPRAVEAVKLCLEKDNKTEAWEKSLKDRWNAKSVYVVGSATASLVNKIGLDAEGAGSG
NAEKLAEYICSKPSSELPLLFPCGTIKGDTLPKMLRDKGIPMESMHVYQTIPHPGIQGSL
ESYYENQGIPASITFFSPSGLKYSLEYIQALSGGSFDQIKFVAIGPSTTRAMAAKGLPVS
CTAESPTPQALAAGIRKALKPNSCC
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttctcttactcaaagatgccaaggatgatgacagcggccaggatccatatatc
caggagctgcggttgtgtggcctggaagctacgctgattcctgttctgtcgtttgaattt
atgtctctgcccagtttgtcagaaaagctgtctcatcctgaaggctttggaggactcatt
ttcaccagccccagggcagtggaagcagtgaagctgtgtttggagaaggacaataaaact
gaagcctgggagaagtctctgaaagacagatggaatgccaagtctgtgtacgtggttgga
agtgccaccgcttctctagtgaataaaattggcctggatgcagaaggagctggcagtgga
aatgcagaaaagctcgctgaatatatttgctcaaagccatcttcagagctgcctcttctc
tttccctgtggaactatcaaaggagacactcttccgaaaatgctcagagacaaagggatt
cccatggaaagcatgcacgtctatcagacaattccacaccctggaatccaagggagcctg
gagagctactatgaaaatcagggcatcccagccagcatcacattcttcagcccctccggc
cttaaatacagcctcgagtatattcaggcgttatctggtggcagcttcgaccagatcaag
tttgtagccatcggccccagtacaactcgtgctatggctgccaagggccttccggtgagc
tgcactgccgaaagccccacaccacaagccctggctgcaggcatcaggaaagcgctgaag
ccaaacagctgctgctga

DBGET integrated database retrieval system