KEGG   Rattus norvegicus (rat): 309165Help
Entry
309165            CDS       T01003                                 

Gene name
Rela, NFkB
Definition
v-rel avian reticuloendotheliosis viral oncogene homolog A
Orthology
K04735  
transcription factor p65
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
Ras signaling pathway
Chemokine signaling pathway
NF-kappa B signaling pathway
HIF-1 signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
Prolactin signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Cocaine addiction
Salmonella infection
Pertussis
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Amoebiasis
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Pancreatic cancer
Prostate cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Inflammatory bowel disease (IBD)
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:rno04014]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:rno04010]
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:rno04064]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:rno04668]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:rno04066]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:rno04151]
Cellular Processes; Cell growth and death; Apoptosis [PATH:rno04210]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:rno04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:rno04621]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:rno04622]
Organismal Systems; Immune system; Cytosolic DNA-sensing pathway [PATH:rno04623]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:rno04660]
Organismal Systems; Immune system; B cell receptor signaling pathway [PATH:rno04662]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:rno04062]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:rno04920]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:rno04917]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:rno04722]
Organismal Systems; Development; Osteoclast differentiation [PATH:rno04380]
Human Diseases; Cancers; Pathways in cancer [PATH:rno05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:rno05202]
Human Diseases; Cancers; Viral carcinogenesis [PATH:rno05203]
Human Diseases; Cancers; Pancreatic cancer [PATH:rno05212]
Human Diseases; Cancers; Acute myeloid leukemia [PATH:rno05221]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:rno05220]
Human Diseases; Cancers; Prostate cancer [PATH:rno05215]
Human Diseases; Cancers; Small cell lung cancer [PATH:rno05222]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:rno05321]
Human Diseases; Substance dependence; Cocaine addiction [PATH:rno05030]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:rno04932]
Human Diseases; Infectious diseases; Salmonella infection [PATH:rno05132]
Human Diseases; Infectious diseases; Pertussis [PATH:rno05133]
Human Diseases; Infectious diseases; Legionellosis [PATH:rno05134]
Human Diseases; Infectious diseases; Tuberculosis [PATH:rno05152]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:rno05166]
Human Diseases; Infectious diseases; Measles [PATH:rno05162]
Human Diseases; Infectious diseases; Influenza A [PATH:rno05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:rno05161]
Human Diseases; Infectious diseases; Hepatitis C [PATH:rno05160]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:rno05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:rno05169]
Human Diseases; Infectious diseases; Amoebiasis [PATH:rno05146]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:rno05145]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:rno05140]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:rno05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q43
AA seq 550 aa AA seqDB search
MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLTPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTEPRPPPRRIAVPSRGPTSVPKPAPQPYAFSTSLSTINF
DEFSPMVLPPGQISNQALALAPSSAPVLAQTMVPSSAMVPSLAQPPAPVPVLAPGPPQSL
SAPVPKSTQAGEGTLSEALLHLQFDADEDLGALLGNNTDPGVFTDLASVDNSEFQQLLNQ
GVAMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPATLGTSGLPNGLSGDEDFSSIADMD
FSALLSQISS
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggacgatctgtttcccctcatctttccctcagagccagcccaggcttctgggccatat
gtggagatcattgagcagcccaagcagcggggcatgcgtttccgttacaagtgcgagggc
cgctctgcaggcagtattcctggggagagaagcacagataccactaagacgcaccccacc
atcaagatcaatggctacacgggaccaggaacagttcgaatctccctggtcaccaaagac
ccacctcaccggcctcatccacatgaacttgtggggaaggactgccgggatggcttctat
gaggctgaactctgcccagaccgatgcatccacagcttccagaacctggggatccagtgt
gtgaagaagcgagacctggagcaagccattagccagcgcatccagaccaacaataacccc
tttcaagttcccatagaggagcagcgcggggactatgacttgaatgcggtccgcctctgc
ttccaggtgacagtgcgggacccatcaggcaggcccctccgcctgacccctgtcctctcg
catccgatttttgataaccgtgcccccaacactgccgagctcaagatctgccgagtaaac
cggaactctgggagctgccttggtggggatgagatcttcttgctgtgtgacaaagtgcag
aaagaagacattgaggtgtatttcacgggacctggctgggaggcacgaggctccttttct
caagccgatgtgcaccggcaagtggccattgtgttccgaactcccccatacgctgaccct
agcctgcaggctcctgtgcgagtgtccatgcagcttcggcggccttctgatcgggagctc
agtgagcccatggagttccagtacttgccagacacagacgatcgccaccggattgaagaa
aaacgcaaaaggacctacgagaccttcaagagcatcatgaagaagagtcctttcaatgga
ccaactgaaccccggcctccaccccgacgtattgctgtgccttcccgaggcccaacttct
gtccccaagccagcaccccagccctatgccttttcaacatccctcagcaccatcaacttt
gatgagttttcccccatggtgttaccacctgggcagatctcaaaccaggccttggccctg
gcaccatcctctgccccagtcctggcccagaccatggtcccctcctcagccatggtacca
agtctggctcagcccccagctcctgtcccagttctagccccaggtcctccccaatccctg
tctgcacctgttccaaagagcacccaggcaggggaaggcaccctgtctgaagccctgcta
cacctgcagttcgatgctgatgaagacttgggggccttgcttggcaacaacacagaccca
ggagtgttcacagacctggcatctgtcgacaactcagagtttcagcagcttctgaaccag
ggtgtggccatgtcccactccacagctgagcccatgctgatggagtaccctgaagctata
actcgcctggtgacaggatcccagaggccccctgatccagctcctgcaaccctggggacc
tcagggcttcccaatggcctctcaggggatgaagacttctcctccattgcggacatggac
ttctcagctcttctgagtcagatcagctcctaa

DBGET integrated database retrieval system