KEGG   Rattus norvegicus (rat): 309407Help
Entry
309407            CDS       T01003                                 

Gene name
Trpm3
Definition
(RefSeq) transient receptor potential cation channel, subfamily M, member 3
  KO
K04978  
transient receptor potential cation channel subfamily M member 3
Organism
rno  Rattus norvegicus (rat)
Brite
Ion channels [BR:rno04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPM (Melastatin/Long TRP)
   309407 (Trpm3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Position
1q51
AA seq 1721 aa AA seqDB search
MGKKWRDAGEMERGCSDREGSAESRRRSRSASRGRFAESWKRLSSKQGSTKRSGLPAQQT
PAQKSWIERAFYKRECVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRN
DIQSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLE
LPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDH
ASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQTMSNPMSKLTVLNSMHSHFILADNG
TTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVP
VVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMEC
MKKKELITVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFIYG
QQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHL
VRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLL
GMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQH
GEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQL
AMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILG
ILLPPSILSLEFKNKDDMPYMTQAQEIHLQEKEPEEPEKPTKEKDEEDMELTAMLGRNNG
ESSRKKDEEEVQSRHRLIPVGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERW
PSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMIL
RLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVV
LMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDRKQVYDSHTPKSAPCG
QNETREDGKTIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQV
WKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHVCCRWRKHESDPDERDYGLKLFITDD
ELKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASL
QTVDIRLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEG
NTFKLQESIDPAGEETMSPTSPTLMPRMRSHSFYSVNVKDKGGIEKLESIFKERSLSLHR
ATSSHSVAKEPKAPAAPANTLAIVPDSRRPSSCIDIYVSAMDELHCDIDPLDNSMNILGL
GEPSFSALAPSTAPSSSAYATLAPTDRPPSRSIDFEDLTSMDTRSFSSDYTHLPECQNPW
DTDPPMYHTIERSKSSRYLATTPFLLEEAPIVKSHSFMFSPSRSYYANFGVPVKTAEYTS
ITDCIDTRCVNAPQAIADRATFPGGLGDKVEDLSCCHPEREAELSHPSSDSEENEARGRR
AANPISSQETENADRTLSNNITVPKIERANSYSAEEPSAPYAHTRKSFSISDKLDRQRNT
ASLRNPFQRSKSSKPEGRGDSVSMRRLSRTSAFHSFESKHN
NT seq 5166 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaagtggagggacgcgggcgagatggagcgaggctgctctgatcgcgagggc
agcgcggagagccgccggcgcagccgcagcgccagccggggcaggtttgccgagtcgtgg
aaaaggttaagttccaagcaggggtccaccaagcgctcgggactgccagcacagcagaca
ccggctcagaaatcctggattgaaagagcattttataaaagagaatgtgttcacatcata
cccagcaccaaagacccccataggtgttgctgtgggcgcctgataggccagcatgtcgga
ctcactcccagtatctctgtgcttcagaatgagaaaaatgagagtcgcctctcccgaaat
gacatccagtctgagaagtggtctatcagcaaacacactcagctcagcccaacggatgct
tttgggactattgagttccaaggaggcggtcattccaacaaagccatgtatgtccgagta
tcttttgatacgaaacctgatctcttgctacacctgatgaccaaggaatggcaactagag
cttcccaaacttctcatctctgtgcacggagggctgcagaactttgaactccagcccaaa
ctcaagcaagtcttcgggaaagggctcatcaaagcagccatgacaactggagcctggatc
ttcactggaggggtcaacacaggtgtcatccgtcatgtgggagatgccttgaaggaccac
gcatctaagtctcgagggaagatatgcaccataggtatcgcaccctggggaattgtggaa
aaccaggaagacctgatcggaagagatgtagtccgaccataccagaccatgtcaaaccct
atgagcaagctcacggttctcaacagcatgcactcccacttcatcctggctgacaatggg
accacgggaaaatacggggccgaggtgaaactccgcagacaactggaaaagcacatttca
ctccagaagataaacacaagaatcggtcaaggggttccagtggtggccctcatcgtggaa
ggaggacccaatgtgatctcaattgttttggaataccttcgagacacccctcctgtacca
gtcgtggtctgcgatggcagtggacgggcatccgacattctggcatttgggcataaatat
tcagaagaaggcggtcttatcaatgaatctttgagggaccagctgttggtgacaatacag
aagaccttcacatacacccgcacccaagcccagcacctgttcatcatcctcatggaatgc
atgaagaagaaggaattgatcacagtgtttcgaatgggatcagaaggccaccaggacatt
gatttagctatcctgacagcactactcaaaggagccaatgcatccgccccagaccagctg
agcttagcattagcctggaacagagttgacatcgctcgcagccagatctttatttacggg
cagcagtggccggtagggtccctggagcaagccatgctggatgccctagtcctggacaga
gtggactttgtgaaattactcatagaaaacggagtaagcatgcaccgttttctcaccatc
tccagactagaggaactgtacaatacgagacatgggccctcaaatacattgtaccacttg
gtcagggatgtcaaaaagggaaacctgcccccggactacagaatcagcctgatagacatt
ggcctggtgatcgagtacctgatgggtggggcttaccgctgcaactacacacgcaagcgc
tttcggaccctctaccacaatctctttggccccaaaaggcccaaagccttgaaactgctg
ggaatggaggatgatattcccttgaggagaggaagaaagacaactaagaaacgtgaggaa
gaggtggacatagacttggatgaccctgagatcaaccacttcccattccctttccatgag
ctgatggtgtgggctgtcctcatgaagaggcagaagatggccctgttcttctggcagcat
ggagaggaggccatggctaaagccctggtggcctgcaagctctgcaaagccatggcccat
gaggcttctgagaatgatatggtggatgacatttcccaagagctgaaccacaactccagg
gactttggccagctggctgtggagcttttggaccagtcctacaaacaggatgagcagctg
gccatgaaactgctgacgtatgagttgaagaactggagcaatgccacatgcctgcagctg
gctgtggctgccaagcaccgtgacttcattgcacacacgtgcagccagatgttacttacc
gacatgtggatgggacggctccgcatgcgaaagaactcaggcctcaaggtaattctggga
attctacttcctccttcaattctcagcttggagttcaagaacaaagatgacatgccctat
atgactcaggcccaagaaattcatctccaagagaaggagccggaggaaccggagaagcct
acaaaggaaaaagatgaagaggacatggagctaacagcaatgttgggacgaaacaatggg
gagtcatccagaaagaaagacgaagaagaagttcaaagcaggcatcgactaatccctgtg
ggccgaaaaatctatgagttctacaacgcacccattgtgaagttctggttctacactctg
gcgtacattggatacctgatgctcttcaattacatcgtgctggtgaagatggagcgctgg
ccttccactcaggaatggatcgtcatctcctacatcttcactctgggaatagagaagatg
agagagatcctgatgtcagagccgggcaagctgctgcagaaagtcaaagtgtggctgcag
gagtactggaacgtcacggacctcatcgccatcctcctcttctcggtgggaatgatcctt
cgtcttcaagaccagcccttcaggagtgacgggagggtcatctactgtgtgaacatcatt
tattggtatatccgtttactagacatcttcggcgtgaacaagtatctgggcccatacgta
atgatgattgggaaaatgatgatagacatgatgtacttcgtcatcattatgctggtggtg
ctgatgagctttggggtcgccaggcaagccattctctttcccaatgaggagccatcttgg
aaactggccaagaatatcttctacatgccttattggatgatttatggggaagtgtttgct
gaccagatagaccgtaagcaagtttatgattctcatacaccaaagtcagctccctgtgga
cagaacgagacccgagaggatggcaagacaatccagctgcccccatgcaagacaggagca
tggattgtgccagccatcatggcctgctacctcttagtagcgaacatccttctggtcaac
ctccttattgctgtcttcaacaatacattttttgaggtcaagtcgatatccaaccaagta
tggaaatttcagaggtaccagctcatcatgactttccatgagagaccagttctgcctcca
ccgctcatcatcttcagtcacatgaccatgatattccagcatgtgtgctgccgatggagg
aagcatgagagtgacccggatgaaagggactacggcctgaaactcttcataactgatgat
gagctcaagaaagtacatgattttgaagagcagtgcatagaggaatatttcagagagaag
gatgaccgcttcaattcatccaatgatgagaggatacgggttacgtcagaaagggtggag
aacatgtccatgaggctggaggaagtcaatgagagagaacattccatgaaggcttcactc
cagactgtggacatccggctagcacagctggaggatctcatcgggcgcatggccactgcc
ctggagcgcctaacaggtctggagcgggcagagtctaacaaaatccgctcaaggacctcc
tcagactgcacagacgcagcctacatcgtccgccagagcagcttcaacagtcaggaaggg
aacaccttcaaacttcaagagagtatagaccctgcaggtgaggagaccatgtccccaact
tctccaaccttaatgccccgtatgcgaagccattctttctattcggtcaatgtgaaagac
aaaggtggtatagaaaagttggagagcattttcaaagaaaggtccctgagcttacaccgt
gctactagctcccactcagtagccaaggagcccaaagctcctgcagcccctgcaaacacc
ttggccattgttcctgattccagaagaccatcgtcatgcatagacatctatgtctctgcc
atggatgagctccactgtgatatagaccctctggataattccatgaacatccttgggctg
ggcgagccaagcttttcagctctagcaccttccacagccccttcaagcagtgcctatgca
acccttgcacctacagaccgacctccaagcaggagcattgattttgaagacctcacctcc
atggacactagatctttttcttcagactatacccacctcccagaatgccaaaacccctgg
gacacagaccctccaatgtaccataccatcgagcgttccaagagtagccgctacctagcc
actacacccttccttctggaagaggcccccattgtaaaatcccatagctttatgttttct
ccttcaaggagttactacgccaactttggggtgcccgtgaaaacagcagaatacacaagt
attacagactgtatcgacacaagatgtgtcaatgccccccaagcaatagctgacagagcc
accttccccggaggtctcggagacaaagtggaagatttatcttgttgccaccctgagcga
gaagcagagctgagccaccctagctctgacagtgaggaaaatgaggccagaggccggaga
gctgccaatccgatatcctctcaggagactgaaaatgcagacagaaccctatccaacaac
atcacagttcccaagatagagcgcgccaacagctactcggcagaggagccaagcgcgcca
tatgcacataccagaaagagcttctccatcagtgacaagcttgatagacagaggaacaca
gcaagcctccgaaatcccttccagagaagtaagtcctccaagccggagggccgaggggac
agcgtatccatgagaagactgtctagaacatcggcttttcatagctttgagagcaagcac
aactaa

DBGET integrated database retrieval system