KEGG   Rattus norvegicus (rat): 309995Help
Entry
309995            CDS       T01003                                 

Gene name
Xrcc4
Definition
X-ray repair complementing defective repair in Chinese hamster cells 4
Orthology
K10886  
DNA-repair protein XRCC4
Organism
rno  Rattus norvegicus (rat)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    309995 (Xrcc4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
2q12
AA seq 323 aa AA seqDB search
MERKVSRISLASEPNVTYFLQVSWEGTIGSGFVITLTDGHSAWTAKVSESEIAQEADDMA
MEQEKYMDELRRALVPESGAAGAYKFIFSKDTQHFSLEKELKDVSFRLGSFNLDKVTNPT
EVIRELICYCLDTIAEKQAKNEHLQKENERLLRDWTDVQGRFEKCVSDKEALEADLYQRF
ILVLNEKKTKIRSLLSEVQQLEKSTKPERETPSSDKIPEEDGLYDGSTDEESGAPVLGAD
TLDKDDSLFSSPDVTDIAPSRKRRHRMQTNLGTEPKMAPQELPLQEKERLGSSPPQTLKE
EGTSAAKMSLETLRNSSPEDLFD
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggaaagtcagcagaatctctctggcttctgaacccaatgtaacctactttcta
caagtgtcttgggaggggacgataggatctggttttgttattacacttacggatggccat
tcagcctggactgcaaaagtttctgaatcggagattgcacaggaagctgatgacatggct
atggagcaggaaaaatacatggatgagctgagacgggcactggtgccagagtcgggagca
gctggtgcatacaagttcatcttttccaaggacactcagcatttctccctggagaaagaa
ctgaaagatgtttctttcagacttggttccttcaacctagacaaagttacaaacccaact
gaagtcatcagagaactcatttgctactgcctggacaccattgcggaaaaacaagccaaa
aacgagcacctgcagaaggaaaacgaaaggctcctgagagattggactgacgttcaaggc
cgatttgagaaatgtgtgagtgacaaagaagccttggaggccgatttgtatcaaagattt
atcttggtgctgaatgagaagaaaacaaaaatccgaagcttgttgagtgaagtccagcag
ctggagaagagtaccaaacctgaaagggaaactccgagttctgacaaaatacctgaggag
gatgggctttatgatggcagcactgatgaagaaagcggagcccctgtgctgggcgcagat
acccttgataaggatgattccttattttcaagtccagatgtcactgatattgcaccaagt
aggaagaggagacaccgaatgcagacaaatcttgggacagaacctaaaatggctccacag
gagctgccactacaggagaaggaaaggcttggctcttcaccgcctcagaccttgaaagag
gagggcacctctgctgcaaagatgtccttagaaaccctgagaaacagcagcccagaagac
ctctttgactag

DBGET integrated database retrieval system