KEGG   Rattus norvegicus (rat): 310194Help
Entry
310194            CDS       T01003                                 

Gene name
Kat8, Myst1
Definition
K (lysine) acetyltransferase 8 (EC:2.3.1.48)
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     310194 (Kat8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q36
AA seq 458 aa AA seqDB search
MAAQGATAAVAATTSGIVGEGEPGPGENTSVEGPARSPGRVSPPTPARGEPEVTVEIGET
YLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQ
KNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVD
KIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKFEKSYRFHLGQCQWRQPPGKEI
YRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVG
YFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLS
YRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPK
LVEEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacagggagcaacagccgctgttgctgcaacaacttcaggaattgtaggggag
ggagagcccggtccgggggaaaatacatcggtcgaggggcctgcccgatccccgggccgg
gtctctccgccgactccggcgcgtggcgaaccagaagtcaccgtggagatcggagaaacg
tacctgtgccggcggcccgacagcacctggcattcagcagaagtgatccagtctcgagtg
aatgaccaagagggccgagaagaattctatgttcattatgtgggctttaacaggcgactg
gacgaatgggtggacaagaaccgacttgctctgactaagacagtgaaggatgccgtgcag
aagaattctgagaagtacctgagtgagctggcggagcagcctgagcgcaagatcactcga
aaccaaaaacgaaagcatgatgagatcaaccatgtacagaagacctatgcagagatggac
cccaccacagcagccttggaaaaggagcatgaggcgatcaccaaagtgaagtatgtagac
aagatccacattggcaactacgaaattgatgcctggtatttctcacctttcccggaggac
tatgggaagcagcccaagctttggctctgcgagtactgcctcaagtacatgaagttcgag
aagagctaccgcttccacctgggccagtgccagtggcggcagcccccagggaaggagatc
tatcgaaagagcaacatctctgtgtatgaagtggatggcaaagaccataagatatattgt
cagaacctgtgtttgctggccaagcttttcctggaccacaagaccttgtattttgatgtg
gagccctttgtcttttacattttgacagaagtagataggcaaggggctcacattgttggc
tacttttctaaggagaaggaatcccctgatggaaacaacgtggcctgcatcctgaccctg
cctccctaccagcggcgtggctatgggaagtttctcattgccttcagttatgagctttct
aagcttgagagtactgtaggctccccagagaagccactgagtgacctgggcaaactcagt
tacagaagctactggtcatgggtcttgctggagatccttcgagacttccggggcacattg
tctatcaaagatcttagccagatgaccagcatcacccagaatgacatcatcagcaccctg
cagtccctcaacatggtcaagtactggaagggccagcatgtgatctgtgtcacacctaag
ctagtagaagaacatctcaaaagtgcccagtataagaagccacctatcacagtggactct
gtctgcctcaagtgggcacccccgaagcacaaacaagtcaagctctccaagaagtga

DBGET integrated database retrieval system