KEGG   Rattus norvegicus (rat): 310306Help
Entry
310306            CDS       T01003                                 

Gene name
Usp13
Definition
ubiquitin specific peptidase 13 (EC:3.1.2.15)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     310306 (Usp13)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   310306 (Usp13)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   310306 (Usp13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
2q25
AA seq 858 aa AA seqDB search
MQRRGALFSVPGGGGKMAAGDLGELLVPHMPTIRVPRSGDRVYKNECAFSYDSPNSEGGL
YVCMNTFLAFGREHVERHFRKTGQSVYMHLKRHMREKVRGASGGALPKRRNSKLFLDLDM
DDDLNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPDTW
ENELPVSKYANNLVQLDNGVRIPPSGWKCARCDLRENLWLNLTDGSVLCGKWFFDSSGGN
GHALEHYRDMGYPLAVKLGTITPDGADVYSFQEEGPVSDPHLAKHLAHFGIDMLHTQGTE
NGFRDNDIKLRVSEWEVIQESGTKLKPMYGPGYTGLKNLGNSCYLSSVMQAIFSIPEFQR
AYVGNLPRIFDYSPLDPTQDFNTQMTKLGHGLLSGQYSKPPVKSELIEQVMKEEHKPQQN
GISPRMFKAFVSKSHPEFSSNRQQDAQEFFLHLVNLVERNRIGSENPSDVFRFLVEERIQ
CCQTRKVRYTERVDYLMQLPVAMEAATNKDELIAYELMRREAETNRRPLPELVRAKIPFS
ACLQAFAEPDNVDDFWSSALQAKSAGVKTSRFASFPEYLVVQIKKFTFGLDWVPRKFDVS
IDMPDLLDISHLRARGLQPGEEELPDISPPIVIPDDSKDRLMNQLIDPSDIDESSVMQLA
EMGFPLEACRKAVYFTGNTGAEVAFNWIIVHMEEPDFAEPLAIPGYGGAGASAFGATGLD
NQPPEEIVAIITAMGFQRSQAVQALQATNHNLERALDWIFSHPEFEEDSDFVIEMENNAN
ANIMSEAKPEGPRVKDGSGMYELFAFISHMGTSTMSGHYVCHIKKEGRWVIYNDHKVCAS
ERPPKDLGYMYFYRRIPS
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccggggcgccctgttcagcgtgccgggtggcggcgggaagatggctgcaggg
gacctgggtgagctgctggtgcctcacatgcccacgatccgcgtgcctaggtcaggggac
cgcgtctacaaaaacgagtgcgccttctcctacgactctccgaactctgaaggtggactc
tatgtatgcatgaatacatttttggcttttggaagggaacacgttgaaagacattttcgg
aaaactggacagagcgtgtacatgcacctgaagaggcacatgcgagagaaggtaagagga
gcttctggtggagctttacccaaaaggaggaattctaaactatttttagatctagatatg
gatgacgatttaaatagtgacgattacgaatatgaagacgaagccaaacttgttatattc
ccagaccactatgaaatagcccttcctaacattgaggagttaccagccctggtaacaatt
gcttgcgatgcagtgctcagctcaaagtccccgtataggaagcaggatccagacacgtgg
gaaaacgaactgccagtatcgaagtacgccaacaacctcgtgcaactggacaacggggtc
aggattcctccgagtggctggaagtgtgcccgatgtgacctgcgggagaacctctggttg
aatctgactgacggctctgttctgtgtgggaagtggttttttgacagctcggggggcaat
ggccatgcgctggagcattacagagacatgggctatcctctggccgtgaagctgggcacc
atcacgcctgatggagcagatgtttattcttttcaagaagaggggcctgtttcggatcct
catttggccaaacacttagcacattttgggattgacatgctccacacacaagggacagag
aatgggttccgggacaatgacatcaagctgagagtcagcgagtgggaagtgatccaggag
tcaggaactaagctgaagccaatgtatggcccagggtacacgggcctgaagaacctgggc
aacagttgctacctcagttctgtcatgcaggccatcttcagcatcccagagttccagaga
gcgtatgtaggaaacctcccaaggatatttgactactcaccattagatccaacgcaggac
ttcaacacacagatgactaagttgggacatggcctcctctctggccagtactcgaagcct
ccagtgaaatctgagctcattgaacaggtgatgaaggaggagcacaagcctcagcagaat
gggatctctccacgaatgttcaaggcctttgtcagcaagagtcacccagaattttcctcc
aatagacagcaggatgcccaggagtttttcttgcatttggttaatctggtagagaggaat
cgcattggctcagaaaacccaagtgatgttttccggtttttggtggaagagcgaattcaa
tgctgtcagaccagaaaggtccgctacacagagagggtggactaccttatgcagttacca
gtggcaatggaggcagcaaccaacaaagatgagctgattgcctatgaactaatgcggagg
gaagcagaaaccaacaggagaccccttccagagctggtacgagccaagatcccattcagt
gcctgtcttcaggcctttgctgaaccagacaatgtggatgatttctggagcagtgctctg
caggccaagtctgcaggggtcaaaacatctcgctttgcctcattccctgaatacttggta
gtgcagataaagaagttcacttttggtcttgactgggttccccgaaaatttgatgtttct
attgatatgccagatctactagatatcagccatctcagagccaggggcttgcagccaggg
gaagaggagcttcctgacatcagcccccccatagtcattcctgatgactcaaaagaccgc
ttgatgaaccagctgatagacccctcagacattgatgagtcctcggtgatgcaactggct
gagatgggcttccctttggaggcctgcaggaaggctgtgtacttcacggggaatactgga
gctgaggtggccttcaactggattatcgtgcacatggaagagcctgattttgctgaacca
ctggccatacctgggtatggaggggctggggcctctgcctttggtgctactggactggac
aaccaacctcctgaggaaatcgtagctattatcactgccatgggattccagcgcagtcag
gcggtacaggctctacaagccacgaaccataacctggaaagagcactggactggatcttc
agccaccctgagtttgaagaggacagtgactttgtcatcgagatggagaacaatgcgaat
gcaaacatcatgtctgaggccaagccagaggggcccagagtcaaggatgggtctggaatg
tatgagttgtttgcgttcatcagtcacatgggaacatctacgatgagtggccattatgtt
tgccatatcaagaaggagggacgatgggtgatctacaatgaccacaaagtttgtgcctca
gaaaggccccccaaagacctgggatatatgtacttttaccgcaggataccaagctaa

DBGET integrated database retrieval system