KEGG   Rattus norvegicus (rat): 310638Help
Entry
310638            CDS       T01003                                 

Gene name
Ash1l
Definition
ash1 (absent, small, or homeotic)-like (Drosophila) (EC:2.1.1.43)
Orthology
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
rno  Rattus norvegicus (rat)
Pathway
Lysine degradation
Tight junction
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    310638 (Ash1l)
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    310638 (Ash1l)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     310638 (Ash1l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
2q34
AA seq 2918 aa AA seqDB search
MDPRNTAMLGLGSDSEGFSRKSPSAISSGTLASKREVEIEGNTDEEDPRKRNRERAIEAG
KDDGLTDAQQQFSVKETNFSEGNLKLKIGLQAKRTKKPPKNLENYVCRPAIKTTVKHSRK
ALKSGKMTDEKNEHCPSKWDSSKLFKKAGDATAIECQSEESVHLHSQGENNPLSKKLSPV
HSQMADYIPAAPPLVGSRDPDIKDRALLNGGTSVTEKLAQLIATCPPSKSSKAKPKKLGT
GTTVGLVSKDLIRKPGVGSIAGIIHKDLIKKPALSTAVGLVTKDPGKKPMFNAAVSLINK
DSVKKLGTGTTAVFINKDLGKKPGTVTTVGLLSKDPGKKLGIGIVPGLVNKESGKKLGLG
TVVGLVNKELGKKLSSTVGLVAKDVTKKIVASSAMGLVNKDIGKKLLSCPIAGQLGSKDA
LNLKSEALLPTQEQLKASCSANISNHESQELPESLKDSATSKTFEKNVMRHSKESMLEKF
SVRKEITNLEKEMFNEGTCIQQDSFSSNERGAFETSKHEKQPPVYCTSPDFQIGGASDAS
TAKSPFGAVGESNLPSSSPTVSVNPLTRNPPETSSQLVPNPLLLNSTAEQMEEISESIGK
NQFTAESTHLNVGHRSLGHSISIECKGIDKELNESKSTHLDISRISSSLGKKPSLASDSG
IHTITPSVVNFTSLFSNKPFLKLGAVAAPDKHCQVAESLSTSFQSKPLKKRKGRKARWTK
VVARSTCRSPKGLDLERSELFKNVSCSSLSNSSEPAKFMKTIGASSFVDHDFLKRRLPKL
SKSSAPSLALLADSEKASHKSFITHKLSSSMCVTSDLLSDIYKPKRGRPKSKEMPQLEGP
PKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQSLSVSPFPKKRGRPKRQMRSPVK
MKPPVLSVAPFVATESPSKLESESENHRSSSDFFESEDQLQDTDDLEDSHRQSVCSVSDL
EMEPDKKISKRNNGQLMKTIIRKINKMKTLKRKKLLNQILSSSVESSNKGKVQSKLHNTV
SSLAATFGSKLGQQINVSKKGTIYIGKRRGRKPKTVLNGLLSGSPASLAVLEQTAQQAAG
SALGQILPPLLPSPASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPYLHVHSRQ
GSMIQTLAMKKAAKGRRRLSPPTLLPNSPSHLSELTSLKEATPSPVSESHSDETIPSDSG
IGTDNNSTSDRAEKFCGQKKRRHSFEHISLIPPETSTVLNSLKEKHKHKCKRRSHDYLSY
DKMKRQKRKRKKKYPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIFRI
NFNSFYTHPSFPLDPLHYIRKPDLKKKRGRPPKMREAMAEMPFMHSLSFPLSSTGFYPSY
GMPYSPSPLTAAPIGLGYYGRYPPTLYPPPPSPSFTTPLPPPSYMHAGHLLLNPTKYHKK
KHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMAYGWMVEHKHRHRHKHREHRSEQPQVSMD
TGSSRSVLESLKRYRFGKDTVGDRYKHKEKHRCHMSCPHLSPSKSLINREEQWVSREPSE
SSSLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHMNLFTSAIGSCRVSNPNSSC
RKKLTDSPGLFPVQDTALSRPHRKEPLPSTERAIQSLAGSQSASDKPSQRSSESTNCSPT
RKRSSSESTSSTVNGIPSRSPRLVASLDDSVDCLLQRIVQHDEQESVEKNGDAPITTVSA
PPSSSPGHSYSKERTLGKSDSLLVPAVPSDSCNSIPLLSEKLASRCSPHHIKRSVVEAMQ
RQARKMCNYDKILATKKNLDHVNKILKAKKLQRQARTGNNFVKRRPGRPRKCPLQAVVSM
QAFQAAQFVNPELNEGEEVSLHLSPDTVTDVIEAVVQSVNLNSEHKKGWKRKNWLLEEQT
RKKQKTVPEEEEQENNKSFIEKPVEIPSPLETPAEPSEPESNLQPVLALIPREKKAPRPP
KKKYQRAGLYSDVYKTTDPKSRLIQLKKEKLEYTPGEHEYGLFPAPIHVDVYVDVKPLSG
YEATTCNCKKPDDDTRKGCGDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERF
RAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVID
SYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYALKDVPAGTELTYDYNFHSFNVEKQ
QLCKCGFEKCRGIIGGKSQRMNGLPSHKGSQPASTHRKSARSKEKRKSKHKLKKRRGHPS
EEPSENINTPTRLTPQLQMKPMSNRERNFVLKHHVFLVRNWEKIHQKQEEVKHSRDIHST
SLYTRWNGICRDDGNIKSDVFMTQFSALQTARSVRTRRLAAAEENLEVARAARLAQIFKE
ICDGIISYKDSSQQALAAPLLNLPPKKKNADYYEKISDPLDLSTIEKQILTGYYKTVEAF
DADMLKVFRNAEKYYGRKSPIGRDVCRLRKAYYSARHEASAQIDEIVGETASEADSSETS
VSEKENSHEKDDDVIRCICGLYKDEGLMIQCDKCMVWQHCDCMGVNTDVEHYLCEQCDPR
PVDREVPMIPRPHYAQPGCVYFICLLRDDLLLRQGDCVYLMRDSRRTPDGHPVRQSYRLL
SHINRDKLDIFRIEKLWKNEKEERFAFGHHYFRPHETHHSPSRRFYHNELFRVPLYEIIP
LEAVVGTCCVLDLYTYCKGRPKGVKEQDVYICDYRLDKSAHLFYKIHRNRYPVCTKPYAF
DHFPKKLTPKRDFSPHYVPDNYKRNGGRSSWKSERSKPLLKDLGQDDDALPLIEEVLASQ
EQAANEMPSPEEPDQERVTGDVSDAEKKPEESSQEPQLASTPEERRHSQRERLNQILLNL
LEKIPGKNAIDVTYLLEEGSGRKLRRRTLFIPENSFRK
NT seq 8757 nt NT seq  +upstreamnt  +downstreamnt
atggaccctaggaatactgctatgttaggattgggttctgactccgaagggttttcaaga
aagagtccttctgccatcagttctggcactctggccagcaagagagaagtagaaatagag
ggtaacacagacgaagaggatcctcgaaagcggaatcgagaaagggccatagaagcagga
aaagacgatggtttgacagatgcacagcaacagttttcagtgaaagaaacaaacttttca
gagggaaatttaaaattgaaaattggccttcaggctaagagaactaaaaagcctccaaag
aacttggagaactatgtgtgtcgccctgccataaaaacaactgtcaagcactcaaggaaa
gcacttaaaagtgggaagatgacagatgagaagaatgaacactgcccttcaaaatgggac
tcttcaaaattgttcaagaaagcaggtgatgctacagccatcgaatgccaatctgaagaa
agtgtccatcttcactctcagggggaaaataaccctttgtctaagaagctttctccagtg
cattcacaaatggccgattacattcctgcagcaccacctcttgttggcagtcgggatcct
gacataaaggacagagcattacttaatggaggaactagtgtaacagaaaagttggcacag
ctcattgctacctgtcctccttccaagtcttccaaggcaaaaccgaagaagttaggaact
ggcactacagtaggattggttagcaaggacttgatcaggaaaccaggtgttggttctata
gctggaataattcataaagacttaattaaaaagcctgctcttagcacagcagttggattg
gtaactaaagatccagggaaaaagcctatgttcaatgcagcagtaagcctgatcaataag
gactctgtgaaaaaattgggaactggcactacagcggtattcattaataaagacttaggc
aaaaagccagggactgtcactacagtaggactgctgagcaaagacccagggaagaagcta
ggaattggtatcgttccagggttagtgaataaagagtctggcaagaaattaggacttggc
accgtagttggactggttaataaagagttgggaaagaaattgagttctacagttggccta
gtggccaaggatgttacgaagaagattgtagcaagctcagcaatgggattggttaataag
gacattggaaagaaattattaagttgccccattgcaggacaactgggcagtaaagatgcc
ttaaaccttaaatctgaagcactgctccccactcaggaacaacttaaggcttcctgtagt
gcaaacataagtaatcatgaaagtcaagaacttcctgagtctctgaaagacagtgctacc
agcaaaacctttgagaagaatgttatgcggcatagtaaagaaagcatgttggaaaagttt
tcagtccgaaaagaaattactaatttggagaaagaaatgtttaatgaaggaacatgcatt
cagcaagacagtttctcatctaatgaaaggggagcctttgagacctcaaagcatgaaaag
caacctcctgtgtattgcacttctcctgactttcaaataggaggtgcctctgacgcatct
acagctaaatctccctttggtgcagtaggagaaagcaatcttccttcctcgtcacctact
gtatctgttaaccctttaaccagaaatccccctgaaacttcttcacagttggttccaaac
ccattacttttaaattctacagcagaacaaatggaagaaatttctgaatctattggaaag
aaccagttcactgctgaaagtacccacttgaatgttggtcataggtcattaggtcatagc
ataagtattgagtgtaaaggaattgataaagaactaaatgaatcaaaaagtacacatcta
gatatttctagaataagttcttccttgggaaaaaagccaagtttggcttctgactctggt
attcatacaattactccttccgttgttaattttactagtttatttagtaacaaacctttt
ctaaagcttggtgcagtagctgcaccagacaagcactgccaggtcgctgaaagcctaagc
actagtttccagtccaaaccattgaaaaaaagaaaagggagaaaagctcggtggactaaa
gtggtggcaagaagcacatgccgatccccaaaaggactagacttagaacggtcagagctt
tttaagaatgtttcctgtagctcactatcaaatagttctgagccagcaaagtttatgaaa
actatcggagcatcgtcttttgtcgatcatgacttccttaaacgccgattgccaaagttg
agtaagtcttcagctccatctcttgctcttttagccgacagtgagaaagcatctcataag
tcttttatcactcacaaactgtcctccagtatgtgtgtcactagtgatcttttgtcggat
atttataagcccaaaagaggaagacccaaatccaaggaaatgcctcaactagaaggtcca
cctaaaaggactttaaaaatacctgcctctaaagttttttctttacagtctaaagaagaa
caagaacccccaattttacaaccagaaattgaaattccttccttcaaacaaagtttgtct
gtatctccttttccaaaaaagagaggcaggcctaagaggcagatgaggtctccagtgaag
atgaagccccctgtactgtcagtggctccatttgttgccactgaaagtccaagtaagcta
gagtctgaaagtgagaaccatagaagtagcagtgatttctttgagagtgaggatcagctt
caggatacagatgacttagaggacagtcataggcaaagtgtctgcagtgtgagtgacctg
gagatggagccggataaaaaaattagcaagcgaaacaatggacaattaatgaaaacaatt
atccgcaaaataaataaaatgaagactttaaagagaaaaaaattgttgaatcagattctt
tcaagttctgtagaatcaagtaataaaggaaaagtacagtccaaacttcataatacagta
tcaagtcttgctgccacgtttggctctaaattggggcaacagataaatgtcagcaagaaa
ggaaccatttacatagggaagagaagggggcgaaaaccaaaaactgtcttaaatggcctt
ctttctggtagccctgccagccttgctgtgcttgaacaaacggctcagcaggcagctggg
tccgcattaggacagatcctccccccgttactgccttcacctgctagtagctctgagatc
cttccatcacctatttgctctcagtcttctgggactagtggaggtcagagccctgtcagt
agtgacgcaggctttgttgaacctagttcagtgccatatttgcatgtgcactcaagacag
ggcagtatgattcagactcttgcaatgaagaaggctgccaaaggcaggaggcggctatct
cctcctactttgttgccaaattctccttctcatttgagtgaactcacatccctgaaagaa
gccactccttccccagttagtgagtctcatagtgatgagaccattcccagtgacagtggc
attgggacagataataatagcacatcagacagggcagagaagttttgtggacagaaaaaa
aggagacattcttttgagcacatttctctgattccccctgaaacttctaccgtcctaaac
agtcttaaagagaaacacaaacacaaatgtaagcgcaggagtcacgattacctcagctat
gacaagatgaaaagacaaaagcgaaaacggaaaaagaaatatccccagcttcgaaatagg
caggatccagacttcatcgcagaactagaggagctgataagtcgtctaagtgagattcgg
attacccatcgaagtcatcatttcattccccgagacctcctgccaactatttttcgaatc
aactttaatagtttctatacacatccttcttttcccttagaccctttgcactacattcgg
aagcctgacttaaaaaagaaaagagggaggccccctaagatgagggaggcaatggcagaa
atgccctttatgcacagccttagttttcctttatctagtactggattttacccttcttat
ggcatgccttattctccttcacccctcactgctgctccgataggattagggtattatgga
cggtatccccccactctctatccaccacctccatctccttcattcaccactccactgcca
cctccctcctatatgcatgctggtcatttattgctcaatcctaccaaatatcataagaaa
aagcataagctccttagacaggaggcttttcttacaaccagcaggactcctctcctttcc
atgagcacctaccccagcgtacctcctgagatggcttatggttggatggtggagcacaaa
cacagacaccgtcacaaacacagagagcaccgttctgaacagccccaggtttccatggat
actggctcctccagatcggtcttggagtctttgaaacgttaccgatttggtaaggatact
gttggagatcgctataagcataaggaaaagcacaggtgtcacatgtcctgccctcatctc
tctccttcaaagagcttaataaacagagaagaacagtgggtttctcgagagccttcagaa
tcaagttctttagccttgggattgcaaacacctttacaaattgactgctcggaaagttct
ccaagtttgtcccttggaggatttactcccaattctgagccagccagcagtgatgaacat
atgaacctttttacaagtgcaataggcagctgcagagtttcaaaccctaactcgagctgc
cggaagaagttaactgacagccctggactctttcctgtacaagatactgcactaagtcgg
cctcacagaaaggaaccgttgccttccactgaaagggcaatacaatcgttggcaggttcc
cagtcagcttccgataaaccttcccagcgatcatcagaaagcacaaattgtagccctacc
cgtaaaaggtcttcatctgaaagtacttcttcaacagtgaatggaattccttccagaagt
cccagattggttgcttctctggatgactctgtagactgtctgttgcagcggatagttcaa
catgatgagcaagagtccgtggagaaaaatggtgatgctccaattacaactgtatctgca
ccaccttcttccagtccaggccatagctacagcaaagagcggaccctagggaaatcagac
agtcttctagtgcctgcagtcccgagtgactcttgtaatagtatcccacttctttctgaa
aagttagcaagcagatgttcccctcatcatatcaagagaagtgtagttgaagctatgcag
cgccaagctcggaaaatgtgcaattatgacaaaatcttggctaccaagaaaaatctggac
catgtcaataaaattttaaaagccaaaaaacttcaaaggcaggccaggacaggaaacaat
tttgtgaaacgcagaccaggtcgacctcggaaatgtcccctccaagctgtggtgtcaatg
caagcattccaggctgcccagtttgtcaacccagaattgaacgaaggcgaagaagtgtcg
ctgcacctaagtccagacacagttacggatgtgatcgaggctgtggttcagagtgtgaac
cttaattcagaacataagaaggggtggaagaggaaaaattggctgttagaagaacagact
agaaaaaagcagaagacagtaccagaggaagaagaacaagaaaacaataaaagctttata
gaaaaaccagttgaaattcccagtcctcttgaaaccccggctgaaccttctgaacctgaa
agtaacttacaacctgtgctggctctcatcccacgagaaaagaaagccccacgtcctcca
aagaagaaataccagagagctgggctgtattctgatgtctacaaaactacagacccaaag
agccgattaatccaactgaagaaagagaagttggagtacactccgggagagcatgagtat
ggactattcccagcacccattcatgttgatgtctacgttgatgtcaaacctctttctggt
tatgaggctaccacctgtaattgtaagaagccagatgatgacaccaggaagggctgtggg
gatgactgcctcaatagaatgatctttgctgagtgttcccctaacacgtgcccctgtggt
gagcagtgctgtaaccaaaggatacagagacatgagtgggtgcagtgtctggaacgattt
cgagctgaggaaaaaggttggggaattagaaccaaagagcccctaaaagctggccaattc
atcattgaatacctgggggaagttgtcagcgaacaagaattcaggaacaggatgattgaa
cagtatcataatcacagtgaccactactgtttaaacctggatagtggaatggtgattgac
agttaccgcatgggaaacgaggccagattcatcaaccacagctgtgacccaaattgtgaa
atgcagaaatggtctgttaacggagtgtaccgcattggattgtatgcacttaaggatgta
cccgctgggaccgagctcacctacgattacaactttcattccttcaatgtagaaaaacag
caactttgtaaatgtggttttgagaagtgtcgaggaatcattggaggcaaaagtcaacga
atgaatggactccctagccataaaggcagccagcctgcaagcacacatagaaagtctgca
cggtcgaaagaaaagcggaagtccaagcacaagctgaagaaaaggagaggccatccctct
gaagagcccagtgaaaacatcaacaccccaacaagattgactccacagttacagatgaag
ccaatgtccaatagagagaggaactttgtgttaaagcatcatgtgttcttggtccgaaac
tgggagaagatccatcagaagcaggaggaagtaaagcacagccgtgacatccactccaca
tccctgtacacccgatggaatggcatctgtagagacgatgggaacattaagtctgatgtc
ttcatgacccagttctctgccctgcagacagcgagatctgttcgcacaagacgcttggca
gctgcagaggagaacctggaagtggctcgggcagcacgcctggcccagatcttcaaagag
atctgcgatggcatcatctcctacaaagattcttcccaacaagctcttgcagctccactg
ttgaatcttcccccaaagaaaaaaaatgctgactattatgagaagatctctgacccgctg
gatctcagcaccatagagaagcagatcctcactggatactacaaaaccgtggaagctttt
gatgccgacatgcttaaggtctttcgaaatgctgagaagtattatgggcgtaaatccccg
attgggagagatgtttgccgcttaagaaaggcctattacagtgcccggcatgaagcttca
gctcaaatcgatgagattgtgggagaaacagccagtgaggcagacagcagtgagacctca
gtgtctgagaaggaaaacagccatgagaaggacgatgatgtgatccgctgcatctgcggc
ctctacaaggatgaaggcctcatgatccaatgtgacaagtgcatggtgtggcagcactgt
gactgcatgggtgtgaacacagacgtggagcactacctttgtgagcagtgtgacccccgg
cccgtggacagggaggtacccatgatccctagaccccactatgcccagcctgggtgtgtc
tactttatctgtttactccgagatgatttgctgcttcgtcagggtgattgtgtgtacctg
atgagggacagtcggcgcacacctgatggccacccagtccgtcagtcctatagactgtta
tctcacattaaccgagataaacttgacatctttagaatcgagaagctttggaagaatgaa
aaagaagaacggtttgcctttggtcaccattatttccgcccccatgaaactcaccactct
ccatcccgtcggttctatcacaatgagctatttcgggtgccactctatgagatcattccc
ttggaagctgtagttgggacctgctgtgtgttggacctttatacgtactgtaaagggaga
cccaaaggagtaaaggaacaagatgtatacatctgtgattatcggcttgacaagtcagca
caccttttttacaagatccatcggaatcgctatcctgtctgcaccaaaccctatgccttt
gatcatttccccaagaagctcactcccaaaagagacttctcacctcattatgtcccagat
aactacaagaggaacggaggacgatcgtcctggaagtctgaacgttcaaagccgctctta
aaagacctcggacaagatgatgatgctttgcccttgattgaagaggtgctggctagtcag
gagcaagcagccaatgaaatgcccagccctgaggagccagaccaggaaagagtcactggg
gacgtcagtgacgctgaaaagaagccagaggagagtagtcaagagccccagttagccagc
acgcctgaggagcgaaggcacagccagagggaacggctcaaccagatcctgctcaacctc
ctggagaaaatacctgggaaaaacgccattgatgtgacctacctgctggaggaagggtca
ggcaggaaactacgaaggcgcactttgtttataccagaaaacagctttcggaagtga

DBGET integrated database retrieval system