KEGG   Rattus norvegicus (rat): 311450Help
Entry
311450            CDS       T01003                                 

Gene name
Pak7, PAK-5, PAK-7
Definition
(RefSeq) p21 protein (Cdc42/Rac)-activated kinase 7 (EC:2.7.11.1)
  KO
K05736  
p21-activated kinase 7 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    311450 (Pak7)
   04012 ErbB signaling pathway
    311450 (Pak7)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    311450 (Pak7)
  Cellular commiunity
   04510 Focal adhesion
    311450 (Pak7)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    311450 (Pak7)
  Development
   04360 Axon guidance
    311450 (Pak7)
 Human Diseases
  Cancers
   05211 Renal cell carcinoma
    311450 (Pak7)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     311450 (Pak7)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   311450 (Pak7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
3q36
AA seq 718 aa AA seqDB search
MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCIT
PIQLAPMKTIVRGNKSCKESSINGLLEDFDNISVTRSNSLRKESPPTPDQGAASRIQGHS
EENGFITFSQYSSESDTTTDYTTEKYRDRSLYGDDLDLYYRGSHAAKQNGHAMKMKHGDA
YYPEMKPLKSDLARFPVDYHTHLDSLSKASEYGDLKWDYQRASSSSPLDYSFQLTPSRTA
GTSRCSKESLAYSESDWGPSFDDYDRRPKSSYLHQTSPQPAMRQRSKSGSGLQEPMMPFG
ASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVFSPPLSGSDTYPRGPTKLPQS
QSKVGYSSSSHQYPGYHKASLYHHPSLQTSSQYISTASYLSSLSISSSTYPPPSWGSSSD
QQPSRVSHEQFRAALQLVVSPGDPREYLDNFIKIGEGSTGIVCIATEKHTGKQVAVKKMD
LRKQQRRELLFNEVVIMRDYHHDNVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMN
EEQIATVCLSVLKALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKRK
SLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLPP
RVKDLHKVSSMLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYRHH
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggaagaaaaagaaaaagatcgaaatatccggcccatctaactttgaacacagg
gttcatactgggtttgatccacaagagcagaagtttactggccttccccagcagtggcac
agcctgttagcagacacagccaacaggcccaagcctatggtggatccatcatgcatcaca
cccatacaactggctcccatgaagacaatcgtcagaggaaataaatcctgcaaggaaagc
tctatcaacggtctgctagaggatttcgacaacatctccgtgactcgctccaactcccta
aggaaagaaagcccacccaccccagatcagggagcagctagccgcattcaaggccactcc
gaagaaaacggcttcattactttctcacaatattctagtgaatctgatactactacggac
tacacaactgaaaagtatagagacaggagtctctatggagacgacctggatctgtactat
agaggcagccatgcagccaagcaaaacgggcatgctatgaagatgaaacatggagatgcc
tactatcctgagatgaagcctttgaaatccgacctggccagattccctgtcgactatcac
acacacttggactcgctgagcaaagcaagtgagtacggtgacctcaagtgggattatcag
cgagcctccagtagctcccctctggactactcattccagctcacgccttccagaactgca
gggaccagcaggtgctccaaggagagtctggcatacagtgaaagtgattggggacccagc
tttgatgactatgataggaggccaaaatcatcctacctgcatcagacaagccctcagcca
gccatgcgccagagatccaagtcaggctcagggcttcaggaacccatgatgccatttgga
gcaagtgcatttaaaactcatcctcaaggacactcgtacaactcctacacctaccctcga
ttgtctgagcccacaatgtgcattccaaaggtggattatgatcgagcacagatggtcttc
agtcctccactgtcagggtccgacacctatcccagaggccccaccaaactacctcaaagt
caaagcaaagtgggctactcttcaagtagccaccagtatcctgggtaccacaaagcatcc
ctataccatcatccgtccctgcaaaccagttctcagtacatctccaccgcttcttacttg
agctctctcagtatctcctcgagcacctaccctccacccagctggggctcctcttcagac
cagcagccctctagggtatcccatgaacagtttcgagctgccctgcaactggtggtcagc
ccaggagaccccagggaatatttggataactttattaaaatcggagaagggtcgacaggc
atcgtgtgcattgcaacagagaagcacacaggcaagcaagtggcggtgaagaaaatggac
ctccgaaagcaacagagacgggaactcctttttaatgaggtcgtgataatgcgtgattac
caccatgacaatgtagttgacatgtataacagctaccttgttggagatgagctctgggtg
gtcatggagtttctagaaggtggtgccttgacagacatcgtcactcataccagaatgaat
gaagaacagatagctactgtctgcctgtcagttctgaaagcgctgtcctaccttcataac
caaggagtgattcacagggacataaagagtgactccattcttctgacaagcgatggccgg
ataaagttatctgactttggcttctgtgctcaagtttccaaagaggtgccaaagaggaag
tcactggtgggtaccccatactggatggctcctgaggtgatttccaggctaccttatggg
acagaggtggacatctggtccctcgggataatggtgatagagatgattgatggtgagcct
ccctatttcaatgagcctcctctgcaggccatgaggaggatccgggacagtttacctcca
agagtgaaggacctgcacaaggtttcttccatgctccgaggattcctagatcttatgttg
gtgagggagccctctcaaagagccacagctcaagaacttcttggacatccattcttaaaa
ttggcaggcccgccatcttgcatcgttcccctcatgagacaatataggcatcactga

DBGET integrated database retrieval system