KEGG   Rattus norvegicus (rat): 311450Help
Entry
311450            CDS       T01003                                 

Gene name
Pak7, PAK-5, PAK-7
Definition
(RefSeq) p21 (RAC1) activated kinase 7 (EC:2.7.11.1)
  KO
K05736  
p21-activated kinase 7 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    311450 (Pak7)
   04012 ErbB signaling pathway
    311450 (Pak7)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    311450 (Pak7)
  Cellular community - eukaryotes
   04510 Focal adhesion
    311450 (Pak7)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    311450 (Pak7)
  Development
   04360 Axon guidance
    311450 (Pak7)
 Human Diseases
  Cancers
   05211 Renal cell carcinoma
    311450 (Pak7)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     311450 (Pak7)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   311450 (Pak7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
3q36
AA seq 718 aa AA seqDB search
MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCIT
PIQLAPMKTIVRGNKSCKESSINGLLEDFDNISVTRSNSLRKESPPTPDQGAASRIQGHS
EENGFITFSQYSSESDTTTDYTTEKYRDRSLYGDDLDLYYRGSHAAKQNGHAMKMKHGDA
YYPEMKPLKSDLARFPVDYHTHLDSLSKASEYGDLKWDYQRASSSSPLDYSFQLTPSRTA
GTSRCSKESLAYSESDWGPSFDDYDRRPKSSYLHQTSPQPAMRQRSKSGSGLQEPMMPFG
ASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVFSPPLSGSDTYPRGPTKLPQS
QSKVGYSSSSHQYPGYHKASLYHHPSLQTSSQYISTASYLSSLSISSSTYPPPSWGSSSD
QQPSRVSHEQFRAALQLVVSPGDPREYLDNFIKIGEGSTGIVCIATEKHTGKQVAVKKMD
LRKQQRRELLFNEVVIMRDYHHDNVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMN
EEQIATVCLSVLKALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKRK
SLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLPP
RVKDLHKVSSMLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYRHH
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggaagaaaaagaaaaagatcgaaatatccggcccatctaactttgaacacagg
gttcatactgggtttgatccacaagagcagaagtttactggccttccccagcagtggcac
agcctgttagcagacacagccaacaggcccaagcctatggtggatccatcatgcatcaca
cccatacaactggctcccatgaagacaatcgtcagaggaaataaatcctgcaaggaaagc
tctatcaacggtctgctagaggatttcgacaacatctccgtgactcgctccaactcccta
aggaaagaaagcccacccaccccagatcagggagcagctagccgcattcaaggccactcc
gaagaaaacggcttcattactttctcacaatattctagtgaatctgatactactacggac
tacacaactgaaaagtatagagacaggagtctctatggagacgacctggatctgtactat
agaggcagccatgcagccaagcaaaacgggcatgctatgaagatgaaacatggagatgcc
tactatcctgagatgaagcctttgaaatccgacctggccagattccctgtcgactatcac
acacacttggactcgctgagcaaagcaagtgagtacggtgacctcaagtgggattatcag
cgagcctccagtagctcccctctggactactcattccagctcacgccttccagaactgca
gggaccagcaggtgctccaaggagagtctggcatacagtgaaagtgattggggacccagc
tttgatgactatgataggaggccaaaatcatcctacctgcatcagacaagccctcagcca
gccatgcgccagagatccaagtcaggctcagggcttcaggaacccatgatgccatttgga
gcaagtgcatttaaaactcatcctcaaggacactcgtacaactcctacacctaccctcga
ttgtctgagcccacaatgtgcattccaaaggtggattatgatcgagcacagatggtcttc
agtcctccactgtcagggtccgacacctatcccagaggccccaccaaactacctcaaagt
caaagcaaagtgggctactcttcaagtagccaccagtatcctgggtaccacaaagcatcc
ctataccatcatccgtccctgcaaaccagttctcagtacatctccaccgcttcttacttg
agctctctcagtatctcctcgagcacctaccctccacccagctggggctcctcttcagac
cagcagccctctagggtatcccatgaacagtttcgagctgccctgcaactggtggtcagc
ccaggagaccccagggaatatttggataactttattaaaatcggagaagggtcgacaggc
atcgtgtgcattgcaacagagaagcacacaggcaagcaagtggcggtgaagaaaatggac
ctccgaaagcaacagagacgggaactcctttttaatgaggtcgtgataatgcgtgattac
caccatgacaatgtagttgacatgtataacagctaccttgttggagatgagctctgggtg
gtcatggagtttctagaaggtggtgccttgacagacatcgtcactcataccagaatgaat
gaagaacagatagctactgtctgcctgtcagttctgaaagcgctgtcctaccttcataac
caaggagtgattcacagggacataaagagtgactccattcttctgacaagcgatggccgg
ataaagttatctgactttggcttctgtgctcaagtttccaaagaggtgccaaagaggaag
tcactggtgggtaccccatactggatggctcctgaggtgatttccaggctaccttatggg
acagaggtggacatctggtccctcgggataatggtgatagagatgattgatggtgagcct
ccctatttcaatgagcctcctctgcaggccatgaggaggatccgggacagtttacctcca
agagtgaaggacctgcacaaggtttcttccatgctccgaggattcctagatcttatgttg
gtgagggagccctctcaaagagccacagctcaagaacttcttggacatccattcttaaaa
ttggcaggcccgccatcttgcatcgttcccctcatgagacaatataggcatcactga

DBGET integrated database retrieval system