KEGG   Rattus norvegicus (rat): 311567Help
Entry
311567            CDS       T01003                                 

Gene name
Itch
Definition
(RefSeq) itchy E3 ubiquitin protein ligase
  KO
K05632  
atrophin-1 interacting protein 4 [EC:2.3.2.26]
Organism
rno  Rattus norvegicus (rat)
Pathway
Ubiquitin mediated proteolysis
Endocytosis
TNF signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    311567 (Itch)
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    311567 (Itch)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    311567 (Itch)
 Human Diseases
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    311567 (Itch)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     311567 (Itch)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  HECT type E3
   311567 (Itch)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
3q42
AA seq 854 aa AA seqDB search
MGSLTMKSQLQITVISAKLKENKKNWFGPSPYVEVTVDGQSKKTEKCNNTNSPKWKQPLT
VIVTPMSKLCFRVWSHQTLKSDVLLGTAGLDIYETLKSNNMKLEEVVMTLQLVGDKEPTE
TMGDLSVCLDGLQVEAEVVTNGETSCSEGATQNDAGCRPKDETRVSTNGSEDPEVAASGE
NKRANGNNSPSLSNGGFKPSRPPRPSRPPPPTPRRPASVNGSPSTNSDSDGSSTGSLPPT
NTNVNSSASEGAASGLIIPRTISGGSGPRPLNTVSQAPLPPGWEQRVDQHGRAYYVDHVE
KRTTRDRPEPLPPGWERRVDNMGRIYYVDHFTRTTTWQRPTLESVRNYEQWQLQRSQLQG
AMQQFNQRFIFGNQDLFATSQNKEFDPLGPLPPGWEKRTDSNGRVYFVNHNTRITQWEDP
RSQGQLNEKPLPEGWEMRFTVDGIPYFVDHNRRATTYIDPRTGKSALDNGPQIAYVRDFK
AKVQYFRFWCQQLAMPQHIKITVTRKTLFEDSFQQIMSFSPQDLRRRLWVIFPGEEGLDY
GGVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQINPASYINPDHLKYFRFIGRFIAMAL
FHGKFIDTGFSLPFYKRILNKPVGLKDLESIDPEFYNSLIWVKENNIEECGLEMYFSVDK
EILGEIKSHDLKPNGGNILVTEENKEEYIRMVAEWRLSRGVEEQTQAFFEGFNEILPQQY
LQYFDAKELEVLLCGMQEIDLNDWQRHAIYRHYTRTSKQIVWFWQFVKEIDNEKRMRLLQ
FVTGTCRLPVGGFADLMGSNGPQKFCIEKVGKENWLPRSHTCFNRLDLPPYKSYEQLKEK
LLFAIEETEGFGQE
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgggtagtctgaccatgaaatctcaacttcagattactgtcatctcagccaaacttaaa
gaaaataaaaagaattggtttggaccaagtccttatgtagaagtcacagtagatgggcag
tcaaagaagacagaaaaatgcaacaatacaaacagccccaagtggaagcagcccctcaca
gttatcgttacccctatgagtaaattatgttttcgtgtgtggagtcaccagaccctgaaa
tctgatgttttattgggaactgctggattagatatttatgaaacattaaagtcaaacaat
atgaaacttgaggaagtagttatgactttgcagcttgtaggtgacaaagagccaacagag
acaatgggagatttgtcagtttgtcttgatgggctgcaagtagaagctgaagttgttact
aatggtgaaacttcatgctcagagggtgctacacagaatgacgctggctgcagacccaaa
gatgaaacaagagtgagcacaaatggatcagaggaccctgaggttgcagcctcgggggag
aacaagagggccaatgggaacaattctccatccctttcaaatggtggttttaagccttct
agacctcctagaccttcaagaccacctccacccaccccacgaagaccagcttctgtcaat
ggctcaccatccacgaactctgacagcgatggatctagcacaggctctttgccacccaca
aatacaaatgtaaattcaagtgcatcggaaggagcagcatctgggttaataattcctcgt
accatctctgggggctcaggccctaggccgctgaatactgtcagtcaagctcccctccca
cctgggtgggagcagagagtagatcagcatgggcgtgcttactatgtagaccatgttgaa
aagcgaacaacacgggatagaccggaacctctacctcctggctgggaacggcgtgtggac
aatatgggacgtatttattatgttgaccatttcacgagaaccacaacatggcagaggccg
accttggaatctgtccggaactatgagcagtggcagctccagcgtagtcaacttcaggga
gcaatgcagcagtttaaccagagattcatctttgggaatcaagatttgtttgctacatca
caaaacaaagagtttgatccccttggtcctttgccccctggatgggagaagagaactgat
agcaacggcagagtgtattttgtcaaccacaacactcggattacacagtgggaagacccc
agaagccaaggtcagttaaatgaaaagcccttaccagaaggctgggaaatgcgattcaca
gtggatggaattccatattttgtggaccacaatagaagagcaactacctacatagatcca
cgcacaggaaagtcagccttagacaacggaccccagatagcctatgttcgggacttcaag
gcaaaagttcagtatttccggttctggtgtcagcaactggccatgccacagcatataaag
atcacagtgacaagaaaaacattgtttgaggattcctttcaacagatcatgagcttcagt
ccgcaagatctgagaagacgtttgtgggtgattttcccaggagaagaaggtttagattat
ggaggtgtagcaagagaatggttctttcttttgtcacatgaagtgttgaacccaatgtat
tgcctgtttgaatatgcagggaaggataactactgcctgcagataaaccccgcttcttat
atcaacccagaccacctgaaatacttccgttttattggcagatttattgccatggctcta
ttccatgggaaattcatagataccggattttctttaccattctataaacgtatcttgaat
aaaccagtgggacttaaggatttagaatctatcgatccagaattttacaattctctcatc
tgggttaaagaaaacaatatcgaggaatgtggtttggaaatgtacttctcagttgataaa
gaaattctgggtgaaattaagagtcatgatttgaaacccaatggtggcaatattctggtg
acagaagaaaataaggaagagtacatcaggatggtcgctgagtggaggttgtctcgggga
gttgaagagcagacacaagctttctttgagggctttaatgaaattcttcctcagcaatat
ttgcaatattttgatgcgaaggaattagaggtccttttgtgtgggatgcaggagatcgat
ttgaatgactggcagagacacgccatctaccgtcactataccaggacgagcaagcagatc
gtgtggttttggcagtttgttaaagaaattgataacgagaagaggatgcgacttctgcag
tttgttaccggaacctgccgattgccagtgggaggatttgctgacctcatggggagtaat
ggaccacagaagttctgcatcgaaaaagttggcaaagaaaattggttacccagaagccat
acttgttttaaccgcctggacctcccaccctacaagagctatgagcaactgaaggaaaag
ctgttatttgccattgaagaaactgaaggatttggacaagagtaa

DBGET integrated database retrieval system