KEGG   Rattus norvegicus (rat): 311569Help
Entry
311569            CDS       T01003                                 

Gene name
Acss2, Acas2
Definition
acyl-CoA synthetase short-chain family member 2 (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    311569 (Acss2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    311569 (Acss2)
   00620 Pyruvate metabolism
    311569 (Acss2)
   00640 Propanoate metabolism
    311569 (Acss2)
Enzymes [BR:rno01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     311569 (Acss2)
Lipid biosynthesis proteins [BR:rno01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   311569 (Acss2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
3q42
AA seq 701 aa AA seqDB search
MGLPEERRKSGSGSRAREETGAEGRVRGWSPPPEVRRSAHVPSLQRYRELHRRSVEEPRE
FWGNIAKEFYWKTPCPGPFLQYNFDVTKGKIFTEWMKGATTNICYNVLDRNVHEKKLGDK
VAFYWEGNEPGETTKITYRELLVQVCQFSNVLRKQGVQKGDRVAIYMPMILELVVAMLAC
ARLGALHSIVFAGFSAESLCERILDSSCCLLITTDAFYRGEKLVNLKELADESLEKCREK
GFPVRCCIVVKHLGRAELGMNDSPSQSPPVKRPCPDVQISWNEGVDLWWHELMQQAGDEF
EPEWCDAEDPLFILYTSGSTGKPKGVVHTVGGYMLYVATTFKYVFDFHPEDVFWCTADIG
WITGHSYVTYGPLANGATSVLFEGIPTYPDEGRLWSIVDKYKVTKFYTAPTAIRMLMKFG
DDPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGSQRCPIVDTFWQTETGGHMLTPLPG
ATPMKPGSASFPFFGVAPAILNESGEELEGEAEGYLVFKQPWPGIMRTVYGNHTRFETTY
FKKFPGYYVTGDGCRRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVV
GHPHPVKGECLYCFVTLCDGHTFSPTLTEELKKQIREKIGPIATPDYIQNAPGLPKTRSG
KIMRRVLRKIAQNDHDLGDTSTVADPSVINHLFSHRCLTTQ
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggggcttcccgaggagcggcgcaagagcggcagcgggagccgggctcgcgaggagacc
ggcgccgagggccgggtgcggggttggtccccgccgccggaggtcagacgctcggcgcac
gtcccctctctgcagcgctaccgcgagctgcaccggcgttctgtggaggagccacgggag
ttttggggaaacattgccaaggaattttactggaaaaccccatgccctggcccattcctc
cagtacaactttgatgtgactaaagggaaaatattcactgagtggatgaaaggagcaacc
acaaacatctgctacaatgtgctggatagaaatgtccatgagaaaaaacttggcgacaaa
gttgctttttactgggagggcaatgagccaggggagaccaccaagatcacataccgtgaa
ctcctggtccaggtgtgtcagttcagcaatgttctccgtaaacagggtgttcagaagggt
gaccgagtggccatctacatgcctatgatcttggagcttgtggtggctatgctggcatgt
gctcgccttggagctttgcactccattgtgtttgcaggcttctctgcagagtctctctgt
gaacggatcttggattccagctgctgcctgctcattactacagatgccttctacaggggg
gaaaaacttgtgaacctgaaggagctggctgatgagtccttggagaagtgccgagagaag
ggtttcccagtgagatgctgcattgtggtcaaacatctggggcgggcagagctgggcatg
aatgactcccccagccagtccccacccgttaagaggccatgtccagatgtccagatctcc
tggaatgaaggggttgacttgtggtggcatgaactcatgcagcaggcaggagatgagttt
gagcctgagtggtgtgatgccgaggaccctctcttcatcttgtataccagtggctccaca
ggcaaacccaagggtgtggtgcacacagttggaggctacatgctctatgtggctacaact
ttcaagtatgtgtttgatttccatccggaggatgtattctggtgcacagcagacattggc
tggatcactggtcattcctatgtcacctatgggccgctggcgaatggtgccaccagtgtt
ttgtttgaggggatccccacatacccagatgaaggccgcttgtggagcattgtggacaaa
tacaaggtgaccaagttctacacggcaccaacagcaatccggatgctcatgaagtttgga
gatgatcctgtcaccaagcatagccgggcatccttgcaggtgctgggcacagtaggtgaa
cccatcaaccctgaagcctggctatggtaccatcgggtagtaggttcccagcgttgcccc
attgtagacaccttctggcaaacagaaacaggtggccatatgctgacccctctccctggt
gccacacccatgaaaccaggttctgcttctttcccgttctttggtgttgcgcctgcaatc
ctgaacgagtcgggggaagaactggaaggggaagctgaaggttatctggtgttcaagcag
ccctggccagggatcatgcgcacagtttatgggaaccacacacgtttcgagaccacctac
tttaagaagttccctggctactacgtgactggagatggctgccgacgggatcaggacggc
tattactggatcactggcaggattgatgacatgctcaatgtgtctggacatcttctgagt
acagcagaggtggaatcagcacttgtggaacatgaggctgttgcagaggcagctgtggtg
ggccaccctcatcctgtgaagggtgaatgcctctactgctttgttaccttgtgtgacggc
cataccttcagccccaccctcactgaggaactcaagaagcagattagagaaaagattggc
cccattgccacaccagactacatccagaatgcacccggcttgcctaaaacacgctcagga
aaaatcatgaggagagtactccggaagattgctcagaatgaccacgacctgggggatacc
tctacagtggctgacccatctgtcatcaaccatctcttcagtcaccgctgcctgaccaca
cagtga

DBGET integrated database retrieval system