KEGG   Rattus norvegicus (rat): 311862Help
Entry
311862            CDS       T01003                                 

Gene name
Lamc3
Definition
laminin gamma 3
Orthology
K06247  
laminin, gamma 3
Organism
rno  Rattus norvegicus (rat)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:rno04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:rno04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:rno04510]
Human Diseases; Cancers; Pathways in cancer [PATH:rno05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:rno05222]
Human Diseases; Infectious diseases; Amoebiasis [PATH:rno05146]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:rno05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Position
3p12-p11
AA seq 1580 aa AA seqDB search
MAVSGILSRLATVVCVALVMLKAHCATGAGMGSCYDGAGRAQRCLPEFENAAFGRRAEAS
HTCGQPPEDFCPHVGAPGAGPQCQRCDDADPRRRHDASYLTDFHSPDDSTWWQSPSMAFG
VQYPTSVNLTLHLGKAYEITYVRLKFHTSRPESFAIYKRTHTGGPWEPYQYYSASCQKTY
GHPEGHYLRPGEDERVAFCTSEFSDISPLNGGNVAFSTLEGRPSAYNFEESPVLQEWVTS
TDLLISLDRLNTFGDDIFKDPRVLQSYYYAVSDFSVGGRCKCNGHASACGPNEAGQLACH
CQHNTTGVDCERCLPFFQDRPWARGTAEDANECLPCNCSGHSEECTFDRELYRSTGHGGH
CQRCRDHTAGPHCEHCEKNYYRWDPKTPCQPCDCHPAGSLSLQCDNSGTCPCKLTVTGWK
CDRCLPGFHSLSEGGCRPCTCNVAGSLGTCDPRSGNCPCKENVEGGLCDRCRPGTFNLQP
HNPAGCSSCFCYGHSKVCAPASGFQEHHIRSDFRHGADGWQARSTEVSERPLQWSQSGIL
LGLRGGEELSAPEKFLGDQRLSYGQPLILTLQVPPGGSPPPMQLRLEGAGLSLALKPSNL
PSSQDTRQPGRVQLQFLLQETSEEAEPPLPAFHFQRLLSNLTTLSIWTSGQGLGHSGHVL
LCEVHLTSARPQRGLAPPASWVETCLCPQGYTGQFCEFCALGYKREIPHGGPYTNCIPCT
CNQHGTCDPNTGICLCGHHTEGPSCERCMPGFYGNAFSGHADDCQPCPCPGQSACTTIPE
SRDVVCTHCPPGQRGRRCESCEDGFFGDPLGLSGAPQPCRRCQCSRNVDLNAVGNCDPHS
GRCLRCLHNTTGAHCEHCQEGFYGSALATRPADKCAPCSCDPRGSSSQKTCNPATGQCAC
LPYVTGRDCSRCSPGFYDLQPGRGCQSCKCHPVGSLENKCHPKTGQCPCRPGVTGQACDR
CQLGFFGFSIKGCRDCRCSPLGAASPQCHENSTCVCRPGFVGYKCDRCQDNFFLVDGDTG
CQECPTCYALVKEEAAKLKTRLMLMEGWLQGSECGSPWGPLDILQGEAPRGDVYQGHHLF
QEARGTFLEQMVGLEESVKATWEQLQVLRGNAHCAQAGAQKTCNQLAELGETLRSSEEEV
LRAASALSFLANLQEGSSAPTNWGRLASEAYILTRSHRDTATKIEATVERALLASNTSYE
LLWKLLKGSVASEAQQELEERYQEVQAAQTALGIAVAEALPKAEKALATVKQVVGAAAPR
LGSMVTPEAMDSQARYLGRRVKALEQKLQQNQAGQAVGALQVEAGRALRKVEPFLQLRNK
TTAALTQVSSAVQAAKVTVIGAKTLLADLEGMKLRFPLPKEQAALKRKAGSIRTRLLKDT
KRKTKQAERMLGNAASLSSNSQKRSKEAELMSKENAKLARAFLREGKQNYRHASRLASQT
QATLRQASRLVLTSEARKQELEEAKQVASGLSTVERQIRESRISLEKDTKVLSELLAKLG
SLGTHQAPAQTLNETQQALESLRLQLDSHGSLHHKLRQLEEESARQELQIQSFENDLAEI
RADKHNLETILSSLPENCAS
NT seq 4743 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgtccgggatcctgtcccgcctggcaacggtggtatgtgtggcgttggtgatg
ctgaaggcgcactgcgcgacgggtgcgggcatgggctcttgctacgacggtgcgggacgc
gcacagcgctgtctgcctgagttcgagaacgcggcgttcggccgacgcgccgaggcctcg
cacacgtgcggacagcccccagaggacttctgtccgcacgtgggggcaccaggagctggg
ccacagtgccagcgctgtgatgatgctgacccccggcgacgccacgacgcctcctacctc
acagacttccacagccctgatgacagcacctggtggcaaagtccgtccatggccttcggg
gtgcagtatcccacttcggttaacctgaccctgcatctagggaaggcctatgagatcacc
tatgtgaggctaaagttccacaccagccgccccgagagctttgccatctacaagcgcacg
cacacgggtggcccctgggagccctaccaatactacagtgcctcctgccagaaaacctat
ggccatcctgagggccactacctgcgacctggtgaagatgagagggtggctttctgcacc
tctgagttcagcgacatctcccccctgaatgggggcaacgtggccttctccactctggag
ggccgtcccagtgcctacaactttgaggagagccctgtgctgcaggagtgggttaccagc
accgatctcctgatctctctggatcgtctcaacacgtttggggatgacatcttcaaggac
cccagagtgctccagtcttactactacgctgtgtctgacttctctgtgggtggcaggtgc
aaatgcaatggtcacgccagtgcgtgcgggcccaacgaggctggtcagctggcttgtcac
tgccagcacaacaccacgggagtggactgtgagcgttgtctacccttcttccaggaccgt
ccgtgggcccgcggcaccgcagaggatgccaacgagtgtctgccctgcaactgtagtggg
cactctgaggagtgcacgtttgacagggagctctatcggagcacgggccatggtgggcac
tgccagcgctgccgagaccacacagctgggccacattgtgagcattgtgagaagaactat
tacagatgggacccgaagacaccatgccaaccctgtgactgccacccagcaggctccctg
agtctccagtgtgacaactcgggcacctgtccctgcaagctgacggtgactggctggaag
tgtgatcgctgcctgcctggattccactcactcagtgagggcggctgcagaccctgtacc
tgcaatgtcgctggcagcttgggcacctgcgatccccgaagtggaaactgcccctgcaaa
gagaatgtggaaggcggtctgtgtgacagatgccgccctgggacttttaacctgcagccc
cataacccagccggctgcagtagctgcttctgttacggccactccaaggtgtgtgcccct
gcttcagggttccaggaacaccacatccgctcagacttccgccatggagctgatggctgg
caggccagaagcacagaggtgtcagagcgtcctctgcaatggagccagagcgggatcctc
ctgggcctgcgaggaggggaggaactctcagccccagagaagttcctgggagaccagaga
ctcagctatggacagccactcatactgaccctccaagtaccccccgggggctccccacct
cctatgcagctgagactggagggggcaggtttatctctggctctgaaaccctccaatcta
cccagctctcaggacaccaggcagccaggacgagttcagctccagttcctcctgcaggag
acttctgaagaggcagagcctccactgcccgccttccacttccagcgcctgctttccaat
ctgaccactctgagcatctggaccagtggccaaggcctgggccactctggccacgtgctc
ttgtgtgaagtccatctcacatcggcccggcctcagcgtgggcttgccccaccagcctct
tgggtggagacctgcttatgtccccagggatacacgggccagttctgtgaattctgtgct
ctgggatacaaaagagaaatacctcatgggggtccctataccaactgcatcccctgcacc
tgcaaccagcatggaacctgtgaccccaacacagggatctgcctgtgtggccaccacacg
gagggtccatcctgtgagcgatgcatgccaggtttctacggtaacgccttctcaggccac
gctgatgattgccagccctgtccatgccctggccaatcagcctgcacgaccatcccagag
agtagagatgtggtgtgcacacactgcccccctggtcagagaggacgacgctgtgagagc
tgtgaagatggcttcttcggagatcccctaggactctctggagctccccagccctgccgc
cgatgccagtgcagcaggaacgtggatctcaatgctgtgggcaactgcgatcctcattct
ggccgctgtctgcgctgtctgcacaacacaacaggggcccactgcgagcactgtcaggag
ggtttctatgggagtgccttggccacgaggcctgcggacaaatgtgctccctgcagctgt
gacccgaggggctcaagcagtcagaagacctgcaacccagcgactggccagtgtgcctgc
ctgccttacgtcaccgggagggattgcagccgctgcagccctggcttctacgacctccag
cctgggaggggctgccagagctgcaaatgtcacccagtgggctccttggagaacaagtgc
caccccaagactggccagtgcccctgtcgacccggtgtcaccggccaagcctgtgacaga
tgccagctgggtttctttggcttctccatcaagggctgccgagactgtaggtgttcccca
ctgggtgctgcctcaccccagtgccatgagaacagcacgtgtgtgtgccggcctggcttc
gtgggctataaatgtgaccgctgccaggacaatttcttcctcgtggatggtgacacaggc
tgccaagagtgccccacctgctatgctctagtgaaggaggaggcagccaagctgaagacc
aggctgatgctgatggaggggtggcttcaggggtccgagtgtggcagcccctggggacca
ctagacattctgcagggagaagcccctcggggggatgtctaccaaggtcaccacctattt
caagaggcccgggggaccttcctggagcagatggtgggcctggaggagtctgtgaaggcc
acttgggagcagctgcaggtgctgagagggaacgcacactgtgcccaggctggagctcag
aagacctgcaaccagctggcagagctgggggagacgctgcgttcctcagaggaggaggtc
ctgcgtgcagcctcagctctctcatttctggcaaatcttcaggaaggatccagcgcaccc
accaattggggtcgcctggcatcagaggcctacatcctcaccaggagccacagggacaca
gccaccaagatcgaagctaccgtggaaagggccctgctcgcctccaacaccagctatgag
ctcctgtggaagctgttgaaaggcagtgtggcctcagaggcccagcaggaactggaggag
aggtaccaggaggtgcaggcagctcagactgccctgggcatagctgtggcagaggcgctg
cccaaagctgaaaaggcactagccacggtgaagcaagtcgttggtgccgcagccccacgt
ctgggctcgatggtcacccctgaagcaatggactcccaagctagatacctaggccggaga
gtgaaagccctggagcagaagctgcagcagaaccaggcaggccaagcggtgggagccctg
caggtagaggctgggagagccttgaggaaggtggagccctttctgcagctacgaaacaag
accacagctgccctgacacaggtttcctcagctgtccaagctgctaaggtgaccgtcata
ggagcgaagaccctgctagctgacctagagggaatgaagctaaggttccctctacccaag
gagcaggcagcgctgaagaggaaagcaggcagcatcaggaccaggctcttgaaggacacg
aagagaaagaccaagcaggcagagaggatgctgggaaatgctgcctcgctctcctccaac
tcccagaagagaagcaaagaagcagaactgatgtccaaggagaatgccaagcttgccaga
gctttcctgagggaagggaagcagaactaccgtcatgccagccgactcgccagccagacc
caggccacactccgccaggcctctcgcctggtgctgacctcagaagcacggaaacaggag
ctggaagaagctaaacaggtggcctctgggctgagcactgtggagcgccagatccgagag
tctcggatctccttggagaaggacaccaaggtcctgtcagagctgctcgcgaaactgggg
tccctgggtacccaccaagcccctgctcagaccctgaacgagacccagcaggcactagaa
agcttgaggctgcagctggattcacatggatccttgcatcacaaactaaggcagctggag
gaagagtctgctcgacaggagctgcagatccagagctttgagaacgacctcgctgagatc
cgcgctgacaagcacaacttggagaccattctaagcagtctaccagagaactgtgccagc
tag

DBGET integrated database retrieval system