KEGG   Rattus norvegicus (rat): 311862Help
Entry
311862            CDS       T01003                                 

Gene name
Lamc3
Definition
laminin gamma 3
Orthology
K06247  
laminin, gamma 3
Organism
rno  Rattus norvegicus (rat)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    311862 (Lamc3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    311862 (Lamc3)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    311862 (Lamc3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    311862 (Lamc3)
   05222 Small cell lung cancer
    311862 (Lamc3)
  Infectious diseases
   05146 Amoebiasis
    311862 (Lamc3)
   05145 Toxoplasmosis
    311862 (Lamc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Position
3p12-p11
AA seq 1580 aa AA seqDB search
MAVSGILSRLATVVCVALVMLKAHCATGAGMGSCYDGAGRAQRCLPEFENAAFGRRAEAS
HTCGQPPEDFCPHVGAPGAGPQCQRCDDADPRRRHDASYLTDFHSPDDSTWWQSPSMAFG
VQYPTSVNLTLHLGKAYEITYVRLKFHTSRPESFAIYKRTHTGGPWEPYQYYSASCQKTY
GHPEGHYLRPGEDERVAFCTSEFSDISPLNGGNVAFSTLEGRPSAYNFEESPVLQEWVTS
TDLLISLDRLNTFGDDIFKDPRVLQSYYYAVSDFSVGGRCKCNGHASACGPNEAGQLACH
CQHNTTGVDCERCLPFFQDRPWARGTAEDANECLPCNCSGHSEECTFDRELYRSTGHGGH
CQRCRDHTAGPHCEHCEKNYYRWDPKTPCQPCDCHPAGSLSLQCDNSGTCPCKLTVTGWK
CDRCLPGFHSLSEGGCRPCTCNVAGSLGTCDPRSGNCPCKENVEGGLCDRCRPGTFNLQP
HNPAGCSSCFCYGHSKVCAPASGFQEHHIRSDFRHGADGWQARSTEVSERPLQWSQSGIL
LGLRGGEELSAPEKFLGDQRLSYGQPLILTLQVPPGGSPPPMQLRLEGAGLSLALKPSNL
PSSQDTRQPGRVQLQFLLQETSEEAEPPLPAFHFQRLLSNLTTLSIWTSGQGLGHSGHVL
LCEVHLTSARPQRGLAPPASWVETCLCPQGYTGQFCEFCALGYKREIPHGGPYTNCIPCT
CNQHGTCDPNTGICLCGHHTEGPSCERCMPGFYGNAFSGHADDCQPCPCPGQSACTTIPE
SRDVVCTHCPPGQRGRRCESCEDGFFGDPLGLSGAPQPCRRCQCSRNVDLNAVGNCDPHS
GRCLRCLHNTTGAHCEHCQEGFYGSALATRPADKCAPCSCDPRGSSSQKTCNPATGQCAC
LPYVTGRDCSRCSPGFYDLQPGRGCQSCKCHPVGSLENKCHPKTGQCPCRPGVTGQACDR
CQLGFFGFSIKGCRDCRCSPLGAASPQCHENSTCVCRPGFVGYKCDRCQDNFFLVDGDTG
CQECPTCYALVKEEAAKLKTRLMLMEGWLQGSECGSPWGPLDILQGEAPRGDVYQGHHLF
QEARGTFLEQMVGLEESVKATWEQLQVLRGNAHCAQAGAQKTCNQLAELGETLRSSEEEV
LRAASALSFLANLQEGSSAPTNWGRLASEAYILTRSHRDTATKIEATVERALLASNTSYE
LLWKLLKGSVASEAQQELEERYQEVQAAQTALGIAVAEALPKAEKALATVKQVVGAAAPR
LGSMVTPEAMDSQARYLGRRVKALEQKLQQNQAGQAVGALQVEAGRALRKVEPFLQLRNK
TTAALTQVSSAVQAAKVTVIGAKTLLADLEGMKLRFPLPKEQAALKRKAGSIRTRLLKDT
KRKTKQAERMLGNAASLSSNSQKRSKEAELMSKENAKLARAFLREGKQNYRHASRLASQT
QATLRQASRLVLTSEARKQELEEAKQVASGLSTVERQIRESRISLEKDTKVLSELLAKLG
SLGTHQAPAQTLNETQQALESLRLQLDSHGSLHHKLRQLEEESARQELQIQSFENDLAEI
RADKHNLETILSSLPENCAS
NT seq 4743 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgtccgggatcctgtcccgcctggcaacggtggtatgtgtggcgttggtgatg
ctgaaggcgcactgcgcgacgggtgcgggcatgggctcttgctacgacggtgcgggacgc
gcacagcgctgtctgcctgagttcgagaacgcggcgttcggccgacgcgccgaggcctcg
cacacgtgcggacagcccccagaggacttctgtccgcacgtgggggcaccaggagctggg
ccacagtgccagcgctgtgatgatgctgacccccggcgacgccacgacgcctcctacctc
acagacttccacagccctgatgacagcacctggtggcaaagtccgtccatggccttcggg
gtgcagtatcccacttcggttaacctgaccctgcatctagggaaggcctatgagatcacc
tatgtgaggctaaagttccacaccagccgccccgagagctttgccatctacaagcgcacg
cacacgggtggcccctgggagccctaccaatactacagtgcctcctgccagaaaacctat
ggccatcctgagggccactacctgcgacctggtgaagatgagagggtggctttctgcacc
tctgagttcagcgacatctcccccctgaatgggggcaacgtggccttctccactctggag
ggccgtcccagtgcctacaactttgaggagagccctgtgctgcaggagtgggttaccagc
accgatctcctgatctctctggatcgtctcaacacgtttggggatgacatcttcaaggac
cccagagtgctccagtcttactactacgctgtgtctgacttctctgtgggtggcaggtgc
aaatgcaatggtcacgccagtgcgtgcgggcccaacgaggctggtcagctggcttgtcac
tgccagcacaacaccacgggagtggactgtgagcgttgtctacccttcttccaggaccgt
ccgtgggcccgcggcaccgcagaggatgccaacgagtgtctgccctgcaactgtagtggg
cactctgaggagtgcacgtttgacagggagctctatcggagcacgggccatggtgggcac
tgccagcgctgccgagaccacacagctgggccacattgtgagcattgtgagaagaactat
tacagatgggacccgaagacaccatgccaaccctgtgactgccacccagcaggctccctg
agtctccagtgtgacaactcgggcacctgtccctgcaagctgacggtgactggctggaag
tgtgatcgctgcctgcctggattccactcactcagtgagggcggctgcagaccctgtacc
tgcaatgtcgctggcagcttgggcacctgcgatccccgaagtggaaactgcccctgcaaa
gagaatgtggaaggcggtctgtgtgacagatgccgccctgggacttttaacctgcagccc
cataacccagccggctgcagtagctgcttctgttacggccactccaaggtgtgtgcccct
gcttcagggttccaggaacaccacatccgctcagacttccgccatggagctgatggctgg
caggccagaagcacagaggtgtcagagcgtcctctgcaatggagccagagcgggatcctc
ctgggcctgcgaggaggggaggaactctcagccccagagaagttcctgggagaccagaga
ctcagctatggacagccactcatactgaccctccaagtaccccccgggggctccccacct
cctatgcagctgagactggagggggcaggtttatctctggctctgaaaccctccaatcta
cccagctctcaggacaccaggcagccaggacgagttcagctccagttcctcctgcaggag
acttctgaagaggcagagcctccactgcccgccttccacttccagcgcctgctttccaat
ctgaccactctgagcatctggaccagtggccaaggcctgggccactctggccacgtgctc
ttgtgtgaagtccatctcacatcggcccggcctcagcgtgggcttgccccaccagcctct
tgggtggagacctgcttatgtccccagggatacacgggccagttctgtgaattctgtgct
ctgggatacaaaagagaaatacctcatgggggtccctataccaactgcatcccctgcacc
tgcaaccagcatggaacctgtgaccccaacacagggatctgcctgtgtggccaccacacg
gagggtccatcctgtgagcgatgcatgccaggtttctacggtaacgccttctcaggccac
gctgatgattgccagccctgtccatgccctggccaatcagcctgcacgaccatcccagag
agtagagatgtggtgtgcacacactgcccccctggtcagagaggacgacgctgtgagagc
tgtgaagatggcttcttcggagatcccctaggactctctggagctccccagccctgccgc
cgatgccagtgcagcaggaacgtggatctcaatgctgtgggcaactgcgatcctcattct
ggccgctgtctgcgctgtctgcacaacacaacaggggcccactgcgagcactgtcaggag
ggtttctatgggagtgccttggccacgaggcctgcggacaaatgtgctccctgcagctgt
gacccgaggggctcaagcagtcagaagacctgcaacccagcgactggccagtgtgcctgc
ctgccttacgtcaccgggagggattgcagccgctgcagccctggcttctacgacctccag
cctgggaggggctgccagagctgcaaatgtcacccagtgggctccttggagaacaagtgc
caccccaagactggccagtgcccctgtcgacccggtgtcaccggccaagcctgtgacaga
tgccagctgggtttctttggcttctccatcaagggctgccgagactgtaggtgttcccca
ctgggtgctgcctcaccccagtgccatgagaacagcacgtgtgtgtgccggcctggcttc
gtgggctataaatgtgaccgctgccaggacaatttcttcctcgtggatggtgacacaggc
tgccaagagtgccccacctgctatgctctagtgaaggaggaggcagccaagctgaagacc
aggctgatgctgatggaggggtggcttcaggggtccgagtgtggcagcccctggggacca
ctagacattctgcagggagaagcccctcggggggatgtctaccaaggtcaccacctattt
caagaggcccgggggaccttcctggagcagatggtgggcctggaggagtctgtgaaggcc
acttgggagcagctgcaggtgctgagagggaacgcacactgtgcccaggctggagctcag
aagacctgcaaccagctggcagagctgggggagacgctgcgttcctcagaggaggaggtc
ctgcgtgcagcctcagctctctcatttctggcaaatcttcaggaaggatccagcgcaccc
accaattggggtcgcctggcatcagaggcctacatcctcaccaggagccacagggacaca
gccaccaagatcgaagctaccgtggaaagggccctgctcgcctccaacaccagctatgag
ctcctgtggaagctgttgaaaggcagtgtggcctcagaggcccagcaggaactggaggag
aggtaccaggaggtgcaggcagctcagactgccctgggcatagctgtggcagaggcgctg
cccaaagctgaaaaggcactagccacggtgaagcaagtcgttggtgccgcagccccacgt
ctgggctcgatggtcacccctgaagcaatggactcccaagctagatacctaggccggaga
gtgaaagccctggagcagaagctgcagcagaaccaggcaggccaagcggtgggagccctg
caggtagaggctgggagagccttgaggaaggtggagccctttctgcagctacgaaacaag
accacagctgccctgacacaggtttcctcagctgtccaagctgctaaggtgaccgtcata
ggagcgaagaccctgctagctgacctagagggaatgaagctaaggttccctctacccaag
gagcaggcagcgctgaagaggaaagcaggcagcatcaggaccaggctcttgaaggacacg
aagagaaagaccaagcaggcagagaggatgctgggaaatgctgcctcgctctcctccaac
tcccagaagagaagcaaagaagcagaactgatgtccaaggagaatgccaagcttgccaga
gctttcctgagggaagggaagcagaactaccgtcatgccagccgactcgccagccagacc
caggccacactccgccaggcctctcgcctggtgctgacctcagaagcacggaaacaggag
ctggaagaagctaaacaggtggcctctgggctgagcactgtggagcgccagatccgagag
tctcggatctccttggagaaggacaccaaggtcctgtcagagctgctcgcgaaactgggg
tccctgggtacccaccaagcccctgctcagaccctgaacgagacccagcaggcactagaa
agcttgaggctgcagctggattcacatggatccttgcatcacaaactaaggcagctggag
gaagagtctgctcgacaggagctgcagatccagagctttgagaacgacctcgctgagatc
cgcgctgacaagcacaacttggagaccattctaagcagtctaccagagaactgtgccagc
tag

DBGET integrated database retrieval system